[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08750.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:195 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  43->187 2fbkA1 a.4.5.28 * 1.6e-12 25.9 %
:HMM:PFM   68->116 PF10939 * DUF2631 0.00068 34.3 35/65  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08750.1 GT:GENE ABF08750.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2030521..2031108) GB:FROM 2030521 GB:TO 2031108 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID ABF08750.1 GB:DB_XREF GI:93354661 LENGTH 195 SQ:AASEQ MARKPVSDSPANAEPVASPSPAAPLARAAGVNIVSSSHLVSVRSPELSEFEFGLNTAYNAYSRWVVRCMGAAGVRDLTFLDVLVLHHVNHRGRAKRLADICFVLNVEDTHLVTYALKKLVGLGLVAGERVGKEATYATTQAGADACARYREIREQCLTSNFTEGSEENLEIGELARLLRVLTGLYEQAARSATSL GT:EXON 1|1-195:0| SEG 9->29|spanaepvaspspaaplaraa| SEG 115->127|alkklvglglvag| HM:PFM:NREP 1 HM:PFM:REP 68->116|PF10939|0.00068|34.3|35/65|DUF2631| HM:SCP:REP 43->187|2fbkA1|1.6e-12|25.9|139/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 67 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-----------------1-1--1--11----1-----1-1---------111----------------------------------------11111111111111111111111111111111--111---11-------------1---------------------------------------------------------------------------1-----1-1---------------------------------1------------------------------------------------------------------------------------------------1-------------------------------------1----1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED cccccccccccccccccccccccHHHHHHccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc //