[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08789.1
DDBJ      :             protein of unknown function DUF849
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  159/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->308 3c6cA PDBj 7e-43 37.9 %
:RPS:PDB   21->304 3e49A PDBj 8e-33 26.5 %
:RPS:SCOP  161->193 1ny5B2  c.37.1.20 * 3e-04 33.3 %
:RPS:PFM   24->308 PF05853 * DUF849 2e-50 45.7 %
:HMM:PFM   22->308 PF05853 * DUF849 3e-104 48.1 270/272  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08789.1 GT:GENE ABF08789.1 GT:PRODUCT protein of unknown function DUF849 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2079344..2080279) GB:FROM 2079344 GB:TO 2080279 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF849 GB:PROTEIN_ID ABF08789.1 GB:DB_XREF GI:93354700 InterPro:IPR008567 LENGTH 311 SQ:AASEQ MAGASSADSFSSQFNVSMHARKTIITCAVTGNIVKPDQHPGLPITPEQIANAALEAADAGAAVAHIHVRDPETGKPSMRLDYYADVIDRIRARNRALIINLTTGPGGRFVPDEDEPRVAAAGTTLLHPLKRVEHIAALRPDVCSLDLNTMNSGADVVINTPGNVRKMAEVIRAAGVMPELEIFDSGDLNMALDFMRDGVLEGPGLWTFVLGVKYGFAPTPETIFYARNMLPPGAHWSAFGIGRAEFPIVAQAWLAGGHVRVGLEDNIYLEKGVLAPSNAALVAKARDIVKSLGGDIASSADARRTLGLREV GT:EXON 1|1-311:0| SEG 50->64|anaaleaadagaava| SEG 87->101|idrirarnraliinl| BL:PDB:NREP 1 BL:PDB:REP 20->308|3c6cA|7e-43|37.9|280/285| RP:PDB:NREP 1 RP:PDB:REP 21->304|3e49A|8e-33|26.5|283/299| RP:PFM:NREP 1 RP:PFM:REP 24->308|PF05853|2e-50|45.7|267/269|DUF849| HM:PFM:NREP 1 HM:PFM:REP 22->308|PF05853|3e-104|48.1|270/272|DUF849| RP:SCP:NREP 1 RP:SCP:REP 161->193|1ny5B2|3e-04|33.3|33/248|c.37.1.20| OP:NHOMO 279 OP:NHOMOORG 165 OP:PATTERN -----------------------1-------1------------------------------------ -----------------11-1----11-111-----11-1---1----------------112--11-11------------1-----------11--------1--------------------1-1--1--------11----1-------------------------------------------------------11-----------------1-1-------------------------111-1-----------------------------------------------------------------------12-------------------------1-----------3----1--1----1----------311---14111----------2-2252261414--111-1-11112122---1262211334--------1-----1-------------------------------1-7------12222221222133323333-22162734--22--1---2-1223-----------------------3-2-1----------------1-111112-------------------------------------1------------------------------------1------------------------------------------------------------------------------------------------1---------------------1------1111121211113---2------------------------------------------------------------------------------------11111-1------ ------------------------------------------------------------------------------------------------------------11------------------------------------------------2---------------------------------------2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 93.9 SQ:SECSTR ##################ccccccEEEEcccccccGGTcTTccccHHHHHHHHHHHHHHTccEEEEcEEcTTTccEEccHHHHTTHHHHHHHHcccEEEEcccccTTcHHHHHHHHHHHccEEEEEccEcccGGGGTccccccHHHHHHHHGGGGcEEccHHHHHHHHHHHHTTTcEEEEEEccHHHHHHHHHHHHTTcccccEEEEEEEccTTcccccHHHHHHHHHHHGGGEEEEEEEcGGGHHHHHHHHHTTTcEEEEcTTTccEEETTEEcccHHHHHHHHHHHHHHTTcccccHHHHHHHTcccG# DISOP:02AL 1-13,311-312| PSIPRED cccccccHHHHHHHccccccccEEEEEEcccccccHHHcccccccHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccc //