[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08804.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   112->179 PF09402 * MSC 0.001 20.6 68/332  
:PROS 1->59|PS00430|TONB_DEPENDENT_REC_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08804.1 GT:GENE ABF08804.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2092439..2093029) GB:FROM 2092439 GB:TO 2093029 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08804.1 GB:DB_XREF GI:93354715 InterPro:IPR010916 LENGTH 196 SQ:AASEQ MKRRRDPLAEGGGDRIDVATSKVGQNPSHANNWETDVGAMQKIVALVGLACFSVSVFAKWEYSENEDKMRGTKVKYAALASDNLVPLDFPYKPGTRLNIMIRKKSGAKDEVILQVDKGQIPCGYSGCKVSAKFDEGQVQTYAGAGTDSGRSDVIFVEASAKFLKALKSSKKVIVEVQFFQSGRQQFEFDSSGLEWK GT:EXON 1|1-196:0| PROS 1->59|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| TM:NTM 1 TM:REGION 37->58| SEG 158->171|asakflkalksskk| HM:PFM:NREP 1 HM:PFM:REP 112->179|PF09402|0.001|20.6|68/332|MSC| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-9,194-194,196-197| PSIPRED cccccccHHcccccEEEEEHHHccccccccccccHHHHHHHHHHHHHHHHHEEEEEEEEcccccccHHccccEEEEcccccccEEEEEcccccccEEEEEEEEccccccEEEEEEcccEEEEccccEEEEEEEcccEEEEEcccccccccccEEEEEcHHHHHHHHccccEEEEEEEEEEcccEEEEEEccccccc //