[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08817.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->81 PF01320 * Colicin_Pyocin 0.0001 43.5 23/85  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08817.1 GT:GENE ABF08817.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2107315..2107725 GB:FROM 2107315 GB:TO 2107725 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08817.1 GB:DB_XREF GI:93354728 LENGTH 136 SQ:AASEQ MTRLRISAAGYTFIADTNPDAPQTVAAFLKLLPYRQKLIHVRWSGEGCWIPLGEFRLGVDFENHTSHPSVGDILFYPGGYSETEIILAYGSCCFASKLGQLAGNHFLTIVEGKENLRALGTKVLWEGAQDVVFELA GT:EXON 1|1-136:0| HM:PFM:NREP 1 HM:PFM:REP 59->81|PF01320|0.0001|43.5|23/85|Colicin_Pyocin| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN ------------------------------1------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1------------------------1---------1------2----------------------------------------------------------------------------------------11--------1--11-------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEEccEEEEEEEcccccHHHHHHHHHcccccEEEEEEEcccEEEEEcHHHEEEccccccccccccccEEEEccccccEEEEEEEccEEEHHHHHHHccccEEEEEEcHHHHHHHHHHHHHccccEEEEEcc //