[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08818.1
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  564/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->91 3hhgG PDBj 3e-11 39.0 %
:BLT:PDB   127->292 2f97A PDBj 5e-15 31.2 %
:RPS:PDB   13->255 1b9nB PDBj 8e-20 11.3 %
:RPS:SCOP  19->88 1ixcA1  a.4.5.37 * 5e-19 50.8 %
:RPS:SCOP  127->296 1i69A  c.94.1.1 * 2e-19 20.0 %
:HMM:SCOP  17->105 1ixcA1 a.4.5.37 * 8.2e-24 40.4 %
:HMM:SCOP  126->314 1ixcA2 c.94.1.1 * 5.3e-22 25.8 %
:RPS:PFM   19->78 PF00126 * HTH_1 4e-08 51.7 %
:RPS:PFM   127->298 PF03466 * LysR_substrate 6e-09 32.7 %
:HMM:PFM   126->303 PF03466 * LysR_substrate 1.2e-32 27.6 174/209  
:HMM:PFM   19->78 PF00126 * HTH_1 2.5e-25 46.7 60/60  
:BLT:SWISS 19->292 BENM_ACIAD 3e-28 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08818.1 GT:GENE ABF08818.1 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2107731..2108669) GB:FROM 2107731 GB:TO 2108669 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID ABF08818.1 GB:DB_XREF GI:93354729 InterPro:IPR000847 InterPro:IPR005119 LENGTH 312 SQ:AASEQ MAAKVNEARGTLMLMTPSLKQLRYFVEIVDAGNFSLAAERLFIAQSALSRQIRDMEATLQVELLVRKPRHVEPTAAGQAFYESARRILSDLAGAAVQARQVQRGGADAIRLLHSSSVVLTPQRCGWLHRWQSDHPAARFEVAQASSEQQSVDIEEGRADLGLARDPVLRRYPNIQIDPMAGERLVVAVCADHPMSRRESLTLSALREMPFVSLPHPERGGLSYRVAQLCQASGFYPTAAGAISRKLSQLSLVAAGFGVAVVPESMQWFGPDGVRLVPLSDAGATTRVVLLSRRDAPEPVAALRTLALSAGAA GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 19->292|BENM_ACIAD|3e-28|33.3|264/304| SEG 92->106|agaavqarqvqrgga| BL:PDB:NREP 2 BL:PDB:REP 15->91|3hhgG|3e-11|39.0|77/294| BL:PDB:REP 127->292|2f97A|5e-15|31.2|160/216| RP:PDB:NREP 1 RP:PDB:REP 13->255|1b9nB|8e-20|11.3|231/245| RP:PFM:NREP 2 RP:PFM:REP 19->78|PF00126|4e-08|51.7|60/60|HTH_1| RP:PFM:REP 127->298|PF03466|6e-09|32.7|156/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 126->303|PF03466|1.2e-32|27.6|174/209|LysR_substrate| HM:PFM:REP 19->78|PF00126|2.5e-25|46.7|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 19->88|1ixcA1|5e-19|50.8|65/84|a.4.5.37| RP:SCP:REP 127->296|1i69A|2e-19|20.0|160/206|c.94.1.1| HM:SCP:REP 17->105|1ixcA1|8.2e-24|40.4|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 126->314|1ixcA2|5.3e-22|25.8|186/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3324 OP:NHOMOORG 572 OP:PATTERN -------------------------------------1---------------1-------------- 231-A1-233421-521----2--2A-----122226DFE-4141112---12422-2--112-21K9A92--------13331----1111---------2--1---13--------------------------24412---3112-3221111111111111264-3--111---1-11-121-----2284444474524346634277656462422-21122212CL-11-1111-11111122225-111121-1123322-1121---112111-----1112222222212---------1---1--------1-1-53-----------2------2----41---68-1---221-------1-14--2------1AAA--62433365666665666-44443F76684-F774554FG796DC11-43C333528343444444566312-1------------------------------157-28SIESSQQURUCCDDBMMaRFEDE9EUMaOZZS--NJB597B9TCK4SE451221262--111-1132445-1------1-422--1-1212-1-11-17511-------------------------65733-124223244434--3433253222521--12-3------98A85E88AA7867699-AA7AA6798AA6B897998FLG89464B8C8CCCCCAC9C98BG56677763-644455435555--1------22222235B---1--------111CBA9C49133F1IJIIELHP5LKNH3BBA1--------2-1123333312243A8787884431111--1-----------------------------------------------------15- --------------------------------------------------------------------------------------------------------------------------------------------------------------4----1-----------1---------1--6-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 96.5 SQ:SECSTR ccccccEEETTETEEEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccHEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTccccHHHHccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGGcTTTccccTTcEEEEEEcGGGcEEEcccEEEEEGGGcTTTcTTcEEEEccTTcccEEEEEEEETTccccHHH########### DISOP:02AL 1-11| PSIPRED ccccccHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEEccccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHccccEEEEHHHHHccccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHcc //