[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08825.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08825.1 GT:GENE ABF08825.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2116844..2117269) GB:FROM 2116844 GB:TO 2117269 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF08825.1 GB:DB_XREF GI:93354736 LENGTH 141 SQ:AASEQ MLDGRRSGCRRNRHYPMKVKRIRPGHTLRRATYARAACLAGLTLLITAASGVALAQSAGMAHLLHTSKSQSSSSAQGGNGQASERGRPSGRRSDKAESERDMADRATRQGQRGGNPRLSPDERKTLRKNLYDLSREMYQGG GT:EXON 1|1-141:0| TM:NTM 1 TM:REGION 35->57| SEG 67->83|sksqssssaqggngqas| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,65-124,140-142| PSIPRED ccccHHHHHHHccccccEEcccccccHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccc //