[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08843.1
DDBJ      :             MoeA-like, domain I and II
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  630/915 : Eukaryota  146/199 : Viruses  0/175   --->[See Alignment]
b.103.1b.85.6c.57.1
:411 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->387 2nqvB PDBj 8e-61 38.4 %
:RPS:PDB   61->321 3dqqB PDBj 8e-31 6.7 %
:RPS:SCOP  9->175 1fc5A2  b.103.1.1 * 4e-47 41.0 %
:RPS:SCOP  186->329 1fc5A3  c.57.1.2 * 3e-44 45.3 %
:RPS:SCOP  335->410 1fc5A1  b.85.6.1 * 2e-13 23.7 %
:HMM:SCOP  9->179 1xi8A2 b.103.1.1 * 2e-50 48.0 %
:HMM:SCOP  181->334 1g8lA3 c.57.1.2 * 2.6e-42 45.6 %
:HMM:SCOP  335->409 1uz5A1 b.85.6.1 * 4.7e-15 37.0 %
:RPS:PFM   10->171 PF03453 * MoeA_N 1e-25 49.1 %
:RPS:PFM   196->322 PF00994 * MoCF_biosynth 2e-12 38.6 %
:HMM:PFM   10->171 PF03453 * MoeA_N 1.2e-46 41.0 161/163  
:HMM:PFM   184->324 PF00994 * MoCF_biosynth 1.7e-30 33.3 132/144  
:HMM:PFM   340->406 PF03454 * MoeA_C 7.2e-13 31.3 67/73  
:BLT:SWISS 10->410 MOEA_HAEIN 8e-63 39.3 %
:PROS 257->290|PS01079|MOCF_BIOSYNTHESIS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08843.1 GT:GENE ABF08843.1 GT:PRODUCT MoeA-like, domain I and II GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2138931..2140166) GB:FROM 2138931 GB:TO 2140166 GB:DIRECTION - GB:PRODUCT MoeA-like, domain I and II GB:PROTEIN_ID ABF08843.1 GB:DB_XREF GI:93354754 InterPro:IPR001453 InterPro:IPR005110 InterPro:IPR005111 InterPro:IPR008284 LENGTH 411 SQ:AASEQ MTQTAARPPMLTMAQALDALMAGVRPITDSETVDTLQANGRVLAAGVTSALRVPPADNTSMDGYVMRAADVPAPGTRLPVSQRIPAGHVGTELAPGTAARIFTGGLIPPGADAVVMQEQCQADGDAVIVNHAPASGEWIRRAGEDIEAGSEILPAGTRLSPQALGLAASVGQAKLDVVRRVRVAVFFTGDELAMPGEPLKPGAIYNSNRFTLRGLLENLGCEVTDFGIVPDTLAATRDTLRRAAEGNDLIITSGGVSVGEEDHIRPAVTAEGRLDLWQIAIKPGKPLAFGQVANGTELPAFFLGLPGNPVSSFVTFLLFVRPFILRLQGVADVTPRRLPLRADFDLPRGDRRNEFLRARINDAGGLDLFPNQSSGVLTSTVWGDGLIDNPPNQTIQRGDVVQFIPFASLLA GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 10->410|MOEA_HAEIN|8e-63|39.3|392/404| PROS 257->290|PS01079|MOCF_BIOSYNTHESIS_2|PDOC00828| SEG 177->185|vvrrvrvav| SEG 231->244|dtlaatrdtlrraa| BL:PDB:NREP 1 BL:PDB:REP 10->387|2nqvB|8e-61|38.4|372/403| RP:PDB:NREP 1 RP:PDB:REP 61->321|3dqqB|8e-31|6.7|252/412| RP:PFM:NREP 2 RP:PFM:REP 10->171|PF03453|1e-25|49.1|161/163|MoeA_N| RP:PFM:REP 196->322|PF00994|2e-12|38.6|127/143|MoCF_biosynth| HM:PFM:NREP 3 HM:PFM:REP 10->171|PF03453|1.2e-46|41.0|161/163|MoeA_N| HM:PFM:REP 184->324|PF00994|1.7e-30|33.3|132/144|MoCF_biosynth| HM:PFM:REP 340->406|PF03454|7.2e-13|31.3|67/73|MoeA_C| GO:PFM:NREP 2 GO:PFM GO:0032324|"GO:molybdopterin cofactor biosynthetic process"|PF03453|IPR005110| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 3 RP:SCP:REP 9->175|1fc5A2|4e-47|41.0|166/173|b.103.1.1| RP:SCP:REP 186->329|1fc5A3|3e-44|45.3|139/149|c.57.1.2| RP:SCP:REP 335->410|1fc5A1|2e-13|23.7|76/82|b.85.6.1| HM:SCP:REP 9->179|1xi8A2|2e-50|48.0|171/0|b.103.1.1|1/1|MoeA N-terminal region -like| HM:SCP:REP 181->334|1g8lA3|2.6e-42|45.6|149/149|c.57.1.2|1/1|Molybdenum cofactor biosynthesis proteins| HM:SCP:REP 335->409|1uz5A1|4.7e-15|37.0|73/0|b.85.6.1|1/1|MoeA C-terminal domain-like| OP:NHOMO 1355 OP:NHOMOORG 838 OP:PATTERN --2231222222222223233333222222222-2223433332424621232122222222222--- 1111232333311221122-22--222222222222232211111222111-3221-2--22112222222--------223111111-------------1-11111-----------------1111111111131131---121111111111111111111111111------------11111---1-13333332313333331111113321111--111111111111111111111111111111------1---11-1-------------------------------------------------------235212222222-2-11---111----13--22232225-33322-22--1212111-----223113131111111111111111-43434445311-2111111111311112131221223222222222211111221-----------------------------11111-1222233333322222332222222232233322222222222222222222111111----------221-2244222323222-3133313132222224322222222222-2111111122222112212111-1-12222212222222222222----111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------111211-111111111111111111111111122221221111111111---------2222222222222221122222223----111111-----------------------------------------12---2---11- ----111-----12111112221313111-111111111111111111111212-2121111---------------------------1211111----1-1111-1--21323121-1-1-122121372121311112111111-11311312112117131112111121111118-11111-221111-11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 97.6 SQ:SECSTR ########ccccHHHHHHHHHHHccccccEEEEEGGGHHTcccEEEEEEcGGGGTTccccHHHHHHHHccccEEEEcHHHHHHcHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHTTTccEEEEcHHHHHHHHHHHccTTccccccEEEEEccccHHHHHHHHHHHTccEEEccGGGGccHHHHHHHHHHHHHHHHTcccccccEEEccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcEEEEcEEEEEcHHHHHHHHHHHTcEEEEEEEEETTEEEEEEccccEETGccEEEEEcTTcccTTHHHHHHHTHHHHHHHHccccccccEEEEEcccccccTTcEEEEEEEEcTTccEEEEEcccTTccTHHHHccEEEEcccccEEcTTcEEEEEEcccc## DISOP:02AL 1-5| PSIPRED ccccccccccccHHHHHHHHHHHcccccccEEEEHHHHcccEEcccccccccccccccccccEEEEEHHHHcccccccEEEEEEcccccccccccccEEEEcccccccccccEEEEEEEEEEcccEEEEEEcccccccccccccccccccEEEccccEEcHHHHHHHHHccccEEEEEEEEEEEEEEccHHHcccccccccccEEEcHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccEEEEEEEEEccccEEEccccccHHHHHHHHccEEEEEccccccccccEEEEEEcHHHcc //