[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08847.1
DDBJ      :             protein of unknown function DUF498
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  133/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.103.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->121 2k2eA PDBj 2e-25 51.2 %
:RPS:PDB   10->123 3cpkA PDBj 5e-27 46.8 %
:RPS:SCOP  14->120 1ihnA  c.103.1.1 * 3e-28 20.2 %
:HMM:SCOP  1->124 2fvtA1 c.103.1.1 * 6.6e-37 48.8 %
:RPS:PFM   14->121 PF04430 * DUF498 2e-25 50.0 %
:HMM:PFM   14->121 PF04430 * DUF498 2.8e-39 47.2 108/110  
:BLT:SWISS 14->126 YHEA_RHOCA 1e-10 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08847.1 GT:GENE ABF08847.1 GT:PRODUCT protein of unknown function DUF498 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2144692..2145072 GB:FROM 2144692 GB:TO 2145072 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF498 GB:PROTEIN_ID ABF08847.1 GB:DB_XREF GI:93354758 InterPro:IPR007523 LENGTH 126 SQ:AASEQ MKLHADQPQSLNTVTGYGPGYIEINAIRHETAVLVMPEGNVEPWPVSRFEDLEPAHFEALLKKSPEVVLLGTGSTLRFPHPRLTAALSRLHIGVDAMDLQAACRTYNILMAEGRKVAAVLLVEPAA GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 14->126|YHEA_RHOCA|1e-10|33.6|107/124| BL:PDB:NREP 1 BL:PDB:REP 1->121|2k2eA|2e-25|51.2|121/158| RP:PDB:NREP 1 RP:PDB:REP 10->123|3cpkA|5e-27|46.8|111/115| RP:PFM:NREP 1 RP:PFM:REP 14->121|PF04430|2e-25|50.0|108/110|DUF498| HM:PFM:NREP 1 HM:PFM:REP 14->121|PF04430|2.8e-39|47.2|108/110|DUF498| RP:SCP:NREP 1 RP:SCP:REP 14->120|1ihnA|3e-28|20.2|99/113|c.103.1.1| HM:SCP:REP 1->124|2fvtA1|6.6e-37|48.8|123/0|c.103.1.1|1/1|MTH938-like| OP:NHOMO 140 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--111-----1111-111111---1--1-1--1-1111111--111-1---11-111111----------------1--------------------------------1--111111111111-111111111111111111111111111111111111111121111-------211111---------------------------------------------------------11---------------------------------1111---------------------------------------------------------------------------------------------111111111----------------------------------------------------------1--------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------21-1------1-------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 98.4 SQ:SECSTR ccccccccTccccEEEEETTEEEETTEEEcccEEEccccccEEcccccGGGccHHHHHHHTcccccEEEEEcTTccccccHHHHHHHHTTTcEEEEEcHHHHHHHHHHHHHTTccEEEEEcccc## DISOP:02AL 1-4,6-6| PSIPRED ccccccccccccEEEEEEccEEEEccEEEEccEEEccccEEcccccccHHHccHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHcccEEEEEEEEcccc //