[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08856.1
DDBJ      :             SSU ribosomal protein S18P
Swiss-Prot:RS18_RALME   RecName: Full=30S ribosomal protein S18;

Homologs  Archaea  0/68 : Bacteria  844/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.8
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->91 2gy9R PDBj 1e-24 63.8 %
:RPS:PDB   35->91 3bbnR PDBj 7e-19 35.1 %
:RPS:SCOP  22->91 1fjgR  a.4.8.1 * 3e-21 38.6 %
:HMM:SCOP  12->93 1i94R_ a.4.8.1 * 1.2e-23 42.7 %
:RPS:PFM   32->84 PF01084 * Ribosomal_S18 4e-11 54.7 %
:HMM:PFM   33->84 PF01084 * Ribosomal_S18 2.5e-25 55.8 52/54  
:BLT:SWISS 1->92 RS18_RALME 3e-51 100.0 %
:PROS 37->60|PS00057|RIBOSOMAL_S18

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08856.1 GT:GENE ABF08856.1 GT:PRODUCT SSU ribosomal protein S18P GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2152957..2153235) GB:FROM 2152957 GB:TO 2153235 GB:DIRECTION - GB:PRODUCT SSU ribosomal protein S18P GB:PROTEIN_ID ABF08856.1 GB:DB_XREF GI:93354767 InterPro:IPR001648 LENGTH 92 SQ:AASEQ MAFVKRDNKNKKRFQQQNPLFKRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLALMPYTDLHKN GT:EXON 1|1-92:0| SW:ID RS18_RALME SW:DE RecName: Full=30S ribosomal protein S18; SW:GN Name=rpsR; OrderedLocusNames=Rmet_1977; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->92|RS18_RALME|3e-51|100.0|92/92| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 37->60|PS00057|RIBOSOMAL_S18|PDOC00056| BL:PDB:NREP 1 BL:PDB:REP 23->91|2gy9R|1e-24|63.8|69/69| RP:PDB:NREP 1 RP:PDB:REP 35->91|3bbnR|7e-19|35.1|57/58| RP:PFM:NREP 1 RP:PFM:REP 32->84|PF01084|4e-11|54.7|53/54|Ribosomal_S18| HM:PFM:NREP 1 HM:PFM:REP 33->84|PF01084|2.5e-25|55.8|52/54|Ribosomal_S18| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01084|IPR001648| GO:PFM GO:0005622|"GO:intracellular"|PF01084|IPR001648| GO:PFM GO:0005840|"GO:ribosome"|PF01084|IPR001648| GO:PFM GO:0006412|"GO:translation"|PF01084|IPR001648| RP:SCP:NREP 1 RP:SCP:REP 22->91|1fjgR|3e-21|38.6|70/73|a.4.8.1| HM:SCP:REP 12->93|1i94R_|1.2e-23|42.7|82/82|a.4.8.1|1/1|Ribosomal protein S18| OP:NHOMO 863 OP:NHOMOORG 844 OP:PATTERN -------------------------------------------------------------------- -111111111111111222-21112-222222-11121111--11-111------1----111-1-1112-111111111111--111111111111--11111111111111111111111111-----------11122111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111-111111111111111111111111-11-111111111111111111111111111111111-11111111111112-111111111111111111111111111111111111111111111111----111111111-11-111-11111111111111111111111111111111111121111111111111111111111111111111111111111-1111111111111-111-11111111111111--111111111-1111111-1-11111111111111111111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111-1111--1111111-111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 84.8 SQ:SECSTR ###########cccccccc##cccccTTTccccccccccccHHHHTTTccccccccccccTTccTTTTTTTHHHHHHHTTTTcccTTcccc# DISOP:02AL 1-25,89-93| PSIPRED cccccccccccccHHccccccccccccccccccccccccccHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHHHccccccccccc //