[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08861.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->47 PF01873 * eIF-5_eIF-2B 0.00029 22.7 22/125  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08861.1 GT:GENE ABF08861.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2156038..2156211 GB:FROM 2156038 GB:TO 2156211 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08861.1 GB:DB_XREF GI:93354772 LENGTH 57 SQ:AASEQ MLQSESVASRRPVKPVPFRQIKGVRVYQGTHRRTMVGNMAAICRMLELAEPSSKTLD GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 25->47|PF01873|0.00029|22.7|22/125|eIF-5_eIF-2B| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,54-58| PSIPRED ccccHHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHcHHHHccc //