[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08865.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->55 PF11278 * DUF3079 1e-20 78.8 %
:HMM:PFM   1->50 PF11278 * DUF3079 1.2e-37 78.0 50/52  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08865.1 GT:GENE ABF08865.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2160301..2160510) GB:FROM 2160301 GB:TO 2160510 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08865.1 GB:DB_XREF GI:93354776 LENGTH 69 SQ:AASEQ MAKKFPLHPAHPERVCWGCDKFCSTDAMGCGNGSSRTQHPAELLGEDWYLHGDWGIEPQLDAPAKTGLG GT:EXON 1|1-69:0| RP:PFM:NREP 1 RP:PFM:REP 1->55|PF11278|1e-20|78.8|52/52|DUF3079| HM:PFM:NREP 1 HM:PFM:REP 1->50|PF11278|1.2e-37|78.0|50/52|DUF3079| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----111-11----1-11-111-11-1--111--1111--1----------1----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111---111------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,63-70| PSIPRED cccccccccccccHHEccccccccHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccc //