[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08869.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->59 PF07960 * CBP4 0.0006 18.9 53/128  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08869.1 GT:GENE ABF08869.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2163200..2163421 GB:FROM 2163200 GB:TO 2163421 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08869.1 GB:DB_XREF GI:93354780 LENGTH 73 SQ:AASEQ MGTITQRVRKDGSIWHTAQIRLKQGGATMFTEAKTLDRKQAAKSWLKKRERKLAQLGQRRPHELRLYPRLQNA GT:EXON 1|1-73:0| HM:PFM:NREP 1 HM:PFM:REP 4->59|PF07960|0.0006|18.9|53/128|CBP4| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1---------------------------------------------------------------------------------------------------1--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1--1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-7,53-57,72-74| PSIPRED cccEEEEEcccccEEEEEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccc //