[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08870.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->90 1b77A PDBj 6e-04 12.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08870.1 GT:GENE ABF08870.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2163669..2164088 GB:FROM 2163669 GB:TO 2164088 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08870.1 GB:DB_XREF GI:93354781 LENGTH 139 SQ:AASEQ MIAKMDTSIRTTESLEPAAEEPTLIELARIFAEKRSQIPDIIPPYIASSLVANERRYYYVAGKDRQGRPRLFEVFLVNPTGELDAVPACFYPGAVLELFPTDLQILAAPDPWGGKVPDLTTTQIADGLQSIYLDEQRNG GT:EXON 1|1-139:0| RP:PDB:NREP 1 RP:PDB:REP 9->90|1b77A|6e-04|12.2|82/228| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 59.0 SQ:SECSTR ########cEEEEccccEEEEccccGGGccccccccccccEEEEEcHHHHHHHHHHHHHTTccEEEEEEETTEEEEEEEcTTTcTTcccc################################################# DISOP:02AL 1-7,136-140| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccEEEEEEccccccccEEEEEEEEccccccccccHHHcccHHEEEccccEEEEEcccccccccccccHHHHHHHHHHHcccccccc //