[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08874.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->133 PF06146 * PsiE 1.4e-13 27.3 66/69  
:HMM:PFM   23->80 PF01810 * LysE 1.9e-05 17.5 57/192  
:BLT:SWISS 16->133 ALX_PHOLL 3e-04 24.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08874.1 GT:GENE ABF08874.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2166477..2166923 GB:FROM 2166477 GB:TO 2166923 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08874.1 GB:DB_XREF GI:93354785 LENGTH 148 SQ:AASEQ MQVEKKITAKITFWFEQSILVAAQILLMAVILAMVIQLWIMFSSDILERVSSIDTVPELMKSVQTAFSGVLLIILGLELMETLRVYFRSHRVRLETILAVAIIAVGRHVINLDVEHMSGGSLMGVAAVVLSLTGGYFLVRFKSPPSAD GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 16->133|ALX_PHOLL|3e-04|24.8|109/100| TM:NTM 4 TM:REGION 16->38| TM:REGION 64->86| TM:REGION 94->116| TM:REGION 119->140| HM:PFM:NREP 2 HM:PFM:REP 68->133|PF06146|1.4e-13|27.3|66/69|PsiE| HM:PFM:REP 23->80|PF01810|1.9e-05|17.5|57/192|LysE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,144-149| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccc //