[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08892.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->52 PF02296 * Alpha_adaptin_C 8e-04 43.8 %
:HMM:PFM   38->86 PF07926 * TPR_MLP1_2 0.00027 26.5 49/132  
:BLT:SWISS 37->96 ANR24_MOUSE 3e-04 35.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08892.1 GT:GENE ABF08892.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2179134..2179424 GB:FROM 2179134 GB:TO 2179424 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08892.1 GB:DB_XREF GI:93354803 LENGTH 96 SQ:AASEQ MFEHMSAEQTAEVIHQCIDMRLKGPFQQVAEAFKARDAKRTEDMAALRQELAALRGEVRALKAERRRADALGAEAERCELVRREAQAAESRLSRRQ GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 37->96|ANR24_MOUSE|3e-04|35.0|60/100| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 38->71| RP:PFM:NREP 1 RP:PFM:REP 21->52|PF02296|8e-04|43.8|32/113|Alpha_adaptin_C| HM:PFM:NREP 1 HM:PFM:REP 38->86|PF07926|0.00027|26.5|49/132|TPR_MLP1_2| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF02296|IPR003164| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF02296|IPR003164| GO:PFM GO:0016192|"GO:vesicle-mediated transport"|PF02296|IPR003164| GO:PFM GO:0030131|"GO:clathrin adaptor complex"|PF02296|IPR003164| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,82-82,85-97| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcc //