[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08896.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.30.5
:315 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   208->279 1eg3A PDBj 7e-04 31.9 %
:RPS:SCOP  182->273 1v7vA2  b.30.5.3 * 4e-04 25.0 %
:HMM:PFM   147->213 PF11185 * DUF2971 3.7e-13 40.3 67/90  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08896.1 GT:GENE ABF08896.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2182359..2183306) GB:FROM 2182359 GB:TO 2183306 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08896.1 GB:DB_XREF GI:93354807 LENGTH 315 SQ:AASEQ MPQDMASAVWQNCSPAPSQFDMPDIEDTTPPPVLYKFMSINGERWTWFQNLIRLGQIYLSSPLDFNDPFDCLPRLDIPSNQDKRVNKRLFRAGARQGHSRKVRREQVGIVRSQSSSVWRENYQNSAHRRIREVGVYCVSANNSHPLMWSHYAEKHTGLSIGFKTGVGIFRIAHKIEYSDIRPHYNHLSTNSKEFYDVYHKKAKFWEYEDEYRILSLNTGIDPKSLMRGIEDDADLMRFIGRPAGHGPATLSPSVIASITFGCNMPPNERTRIVDFVRAQGLNVDFFEAVLDEHKFALSIRPFHIEQGRVRNRRRQ GT:EXON 1|1-315:0| BL:PDB:NREP 1 BL:PDB:REP 208->279|1eg3A|7e-04|31.9|72/260| HM:PFM:NREP 1 HM:PFM:REP 147->213|PF11185|3.7e-13|40.3|67/90|DUF2971| RP:SCP:NREP 1 RP:SCP:REP 182->273|1v7vA2|4e-04|25.0|80/270|b.30.5.3| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1---------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1-------------1-1-------------------1------------1-------1-------------------------------------------------------1---1-------------------------------------------1-------------------------------------------------1-----------------------------------------1---------------------------------------------1-1----1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 22.9 SQ:SECSTR ###############################################################################################################################################################################################################HHHHHHHccTTcccHHHHHHHHHHHHHHHHHTTcGGGGTccccHHHHHHHHHHTTTcccccHHHHHHHHHTc#################################### DISOP:02AL 1-5,308-308,310-316| PSIPRED ccHHHHHHHHHcccccccccccccccccccccEEEEEEEcccccHHHHHHHHHccEEEEccHHHcccHHHccccccccccccccccHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEccccccccEEEEcccccEEEEEEEcccccccccccEEEEEEEcccccccccHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEcccHHcEEEEccccccccHHHHHccc //