[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08915.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->234 PF02683 * DsbD 1.1e-06 23.5 162/211  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08915.1 GT:GENE ABF08915.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2205376..2206143) GB:FROM 2205376 GB:TO 2206143 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF08915.1 GB:DB_XREF GI:93354826 LENGTH 255 SQ:AASEQ MPFGVLFSVFTLALLGGVHCAAMCGGIAIAVEQRQSGAAVAVVNVVHRSRLHWWLELLVMHAGRLTTYVLLGALMGAVGATVWKQDYLPVQRWLYGAGSLLLVLTGVWLLRGRVMRAAWLERLAARAASYVVQGIASLGMQMPLRLRRHAPIMRRYGMGLAWGLVPCGMVYGALALALLAGNAPSGALVMAAFGIGTLPNLLVISGLSGYLRQLSRRPSVRVGAALIVIGFGALGVARAVWLPDTLANHGFCVVF GT:EXON 1|1-255:0| TM:NTM 7 TM:REGION 6->28| TM:REGION 57->79| TM:REGION 90->111| TM:REGION 121->142| TM:REGION 158->180| TM:REGION 189->211| TM:REGION 226->248| SEG 100->114|lllvltgvwllrgrv| SEG 116->128|raawlerlaaraa| SEG 172->188|galalallagnapsgal| HM:PFM:NREP 1 HM:PFM:REP 50->234|PF02683|1.1e-06|23.5|162/211|DsbD| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,34-46| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEc //