[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08916.1
DDBJ      :             transcriptional regulator, Crp/Fnr family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  452/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->222 3i54D PDBj 3e-09 22.8 %
:RPS:PDB   12->227 3e6cC PDBj 8e-35 15.0 %
:RPS:SCOP  33->149 1cgpA2  b.82.3.2 * 7e-18 17.1 %
:RPS:SCOP  150->227 2gauA1  a.4.5.4 * 2e-10 18.2 %
:HMM:SCOP  8->149 2gauA2 b.82.3.2 * 4e-25 30.5 %
:HMM:SCOP  150->231 2gauA1 a.4.5.4 * 2e-18 38.3 %
:RPS:PFM   39->117 PF00027 * cNMP_binding 1e-07 35.4 %
:HMM:PFM   35->121 PF00027 * cNMP_binding 1.1e-16 27.6 87/91  
:HMM:PFM   178->209 PF00325 * Crp 2.4e-14 65.6 32/32  
:BLT:SWISS 5->227 BTR_BORPE 2e-78 60.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08916.1 GT:GENE ABF08916.1 GT:PRODUCT transcriptional regulator, Crp/Fnr family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2206256..2206954 GB:FROM 2206256 GB:TO 2206954 GB:DIRECTION + GB:PRODUCT transcriptional regulator, Crp/Fnr family GB:PROTEIN_ID ABF08916.1 GB:DB_XREF GI:93354827 InterPro:IPR000595 InterPro:IPR001808 InterPro:IPR012318 LENGTH 232 SQ:AASEQ MSPRCSTCAMGQLCLPVGMSQQDLAKMDTLVQERVRVHKGETLYRMGEPLTAVYAIRFGTLKTHVTMEDGRTQITGFHLPGEVVGLDGLGEMQHASDATALEDTEVCVVRFDDLQSLSGTLPSLQQQFLRLMSKEISQDQIMLITLGSMRAEERLAAFLVNMSERLSMRGYSSSEFVLRMSREEIGSYLGLKLETVSRLFSRFAEAGLIQIRQRHVKLVDMEGIRQVYSRNC GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 5->227|BTR_BORPE|2e-78|60.5|223/242| BL:PDB:NREP 1 BL:PDB:REP 39->222|3i54D|3e-09|22.8|184/228| RP:PDB:NREP 1 RP:PDB:REP 12->227|3e6cC|8e-35|15.0|213/225| RP:PFM:NREP 1 RP:PFM:REP 39->117|PF00027|1e-07|35.4|79/90|cNMP_binding| HM:PFM:NREP 2 HM:PFM:REP 35->121|PF00027|1.1e-16|27.6|87/91|cNMP_binding| HM:PFM:REP 178->209|PF00325|2.4e-14|65.6|32/32|Crp| RP:SCP:NREP 2 RP:SCP:REP 33->149|1cgpA2|7e-18|17.1|117/129|b.82.3.2| RP:SCP:REP 150->227|2gauA1|2e-10|18.2|77/81|a.4.5.4| HM:SCP:REP 8->149|2gauA2|4e-25|30.5|141/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 150->231|2gauA1|2e-18|38.3|81/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 756 OP:NHOMOORG 453 OP:PATTERN -------------------------------------------------------------------- 1-2-2--1111---------------------------------11111---111111----3----111------------1--1---------------2111321-1--------------------------2--111-1-----------------------1-1-------------122--11--1--------------------------11-----------11--------------------212--22--111-----11221-12-------------------------------------------1-231222222222211----333-12-11--122222--2-1111--------3114------28664324344333323333332-47445634242-12234445224411---3214332111111111113111-423------------------------------1221-1111153343443132333344441424425542223222211133321211--11111111111111211321-1211-12-11-1122121-1------21-1-----------------------22111111212111211111111112111111----411------11111111111111111-1111111111111--11-1111111111111111111111111111111111-111111111111---1---------11131111111111111111----------1111111221131322211---------1111111111111212211111---------1-11--11----------2------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 98.7 SQ:SECSTR HHHHHHHHHHTccccccccccGGGGGGGGGcEEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEcccccccccccEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEEccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEEccHHHHHHHHc### DISOP:02AL 1-1,231-233| PSIPRED ccccccccccccccccccccHHHHHHHHHHccEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEHHHHcccccEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHHHccc //