[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08932.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  570/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->277 2r6gG PDBj 6e-15 26.8 %
:RPS:PDB   167->206 3dhwA PDBj 3e-08 35.0 %
:RPS:SCOP  10->277 2r6gG1  f.58.1.1 * 2e-27 27.5 %
:HMM:PFM   92->277 PF00528 * BPD_transp_1 1.9e-22 21.3 174/185  
:BLT:SWISS 1->282 UGPE_YERE8 1e-98 59.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08932.1 GT:GENE ABF08932.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2224448..2225296) GB:FROM 2224448 GB:TO 2225296 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABF08932.1 GB:DB_XREF GI:93354843 InterPro:IPR000515 LENGTH 282 SQ:AASEQ MVERRPVLDFITHLVLIVGIAIVAFPVYLTFVASTLTAEQVLDAPMTLIPGSHLIENYRTVLFQGVGEAASPVSTMMKNSLIMALGIALGKIAISIISAFAIVYFRFPLRKTFFWMIFITLMLPVEVRILPTYKVVSDLGMLDSYFGLTIPIIASATATFLFRQFFLTIPDELAEAARIDGAGPLRFFWDVVLPLSRTSIAALFVIQFIYGWNQYLWPLLITTQKSMTPVVVGVTQMISRSGDAATDWNLVMATVMLAMIPPAVVVVLMQRWFVKGLVETEK GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 1->282|UGPE_YERE8|1e-98|59.8|281/281| TM:NTM 6 TM:REGION 11->33| TM:REGION 79->101| TM:REGION 112->134| TM:REGION 142->164| TM:REGION 188->210| TM:REGION 248->270| SEG 92->102|iaisiisafai| BL:PDB:NREP 1 BL:PDB:REP 47->277|2r6gG|6e-15|26.8|228/284| RP:PDB:NREP 1 RP:PDB:REP 167->206|3dhwA|3e-08|35.0|40/203| HM:PFM:NREP 1 HM:PFM:REP 92->277|PF00528|1.9e-22|21.3|174/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 10->277|2r6gG1|2e-27|27.5|262/284|f.58.1.1| OP:NHOMO 3180 OP:NHOMOORG 605 OP:PATTERN 22--3--12333233-513331--61151-3-----------------------1131--1421---- ---1j1-3223-1-23344-413347444443144414575437J*a2DHF4RKN12B--967BH4EPXG68666GDA1---4-------------------------1---------------------------9BB78---66211311-11221112212221333--1-----1----CD255EF-953222222331132223SH994822354A29357787779*111111111111111-1---541122--22233--22---1-42552325333422666777766664333344443333355---5553G4-3A1111121514C2--1445f-24233E--231--1I--1665J2-1-------111112-C981--535534467466666D---6--4-19P--WVVJaYQnjbTP22---8G88768D85--------2111--11-----------------------------1---2-1444368877653444448A5554346562223--2237-23342668D----1--3--------------1-2--111--11111---------222223----------1------------------125-----1-6----------------------1---------25661413333333333-33333334333323333325656611123222222222222226-1133321-488888888888---------11111-76D111111-----1--1----------1-11111233322232545----------111-222223154411111111111111--------------------811111-11-1111111---13----7KFB79R8B9-2- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 81.9 SQ:SECSTR ##############################################cccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHTTccccccHHHHHHHHHHHHHHHcTTccTTcHTTTTHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGccccccccccHHHHHHHHHHTHHHHHHHHHHHTTTccccc##### DISOP:02AL 1-1,281-283| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //