[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08937.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 19->94 SPPA_BACHD 6e-04 34.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08937.1 GT:GENE ABF08937.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2230438..2230746 GB:FROM 2230438 GB:TO 2230746 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF08937.1 GB:DB_XREF GI:93354848 LENGTH 102 SQ:AASEQ MRASLGALLAAISIAACATNSPADARQTLVGEIYVKGNDPFPTVMLETSDMTFWELSGVAIADARALTGKRVTARGRIERPPGPDVWLPSLRVDSVPEPVSP GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 19->94|SPPA_BACHD|6e-04|34.3|70/100| SEG 3->18|aslgallaaisiaaca| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,99-103| PSIPRED ccHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEccccccEEEEEcccccEEEEEcccHHHHHHHHccEEEEEEEEEccccccccccccEEccccccccc //