[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08941.1
DDBJ      :             L-glutamine synthetase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  779/915 : Eukaryota  101/199 : Viruses  0/175   --->[See Alignment]
d.128.1d.15.9
:471 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->471 1f1hA PDBj 0.0 64.1 %
:RPS:PDB   3->471 2bvcA PDBj e-156 50.5 %
:RPS:SCOP  4->103 1f1hA1  d.15.9.1 * 2e-32 57.0 %
:RPS:SCOP  104->471 1f1hA2  d.128.1.1 * e-158 66.0 %
:HMM:SCOP  4->104 1f52A1 d.15.9.1 * 3.2e-36 50.0 %
:HMM:SCOP  104->471 1f52A2 d.128.1.1 * 1.4e-135 47.3 %
:RPS:PFM   18->96 PF03951 * Gln-synt_N 9e-14 47.4 %
:RPS:PFM   106->381 PF00120 * Gln-synt_C 2e-76 60.1 %
:HMM:PFM   105->381 PF00120 * Gln-synt_C 1.1e-103 55.1 254/258  
:HMM:PFM   16->97 PF03951 * Gln-synt_N 2e-32 52.4 82/84  
:BLT:SWISS 9->471 GLNA_AZOVI 0.0 68.3 %
:PROS 52->70|PS00180|GLNA_1
:PROS 261->276|PS00181|GLNA_ATP
:PROS 388->400|PS00182|GLNA_ADENYLATION

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08941.1 GT:GENE ABF08941.1 GT:PRODUCT L-glutamine synthetase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2234351..2235766) GB:FROM 2234351 GB:TO 2235766 GB:DIRECTION - GB:PRODUCT L-glutamine synthetase GB:PROTEIN_ID ABF08941.1 GB:DB_XREF GI:93354852 InterPro:IPR001637 InterPro:IPR004809 InterPro:IPR008146 InterPro:IPR008147 LENGTH 471 SQ:AASEQ MAQSVADVMKLVNENDVKFVDFRFTDTKGKEQHVSVPVSHFDEDKFESGHAFDGSSIAGWKGIEASDMLLMPDSGTAYIDPFYEEPTLVLSCDVIEPSDGKGYDRDPRSIAKRAEAYLKSTGLGDTAFFGPEPEFFIFDGVTWNIDMQGCSVKIQSEEAPWSSGKEFEHGNSGHRPGKKGGYFPVAPIDTFQDMRSEMCLILESLGIPVEVHHHEVAGQGQNEIGTRFSTLVQRADWTQLQKYVIQNVAHTYGKTATFMPKPIVGDNGSGMHVHQSIWKDGQNLFAGNGYAGLSEFALYYIGGIIKHARALNAITNPGTNSYKRLVPGFEAPVKLAYSARNRSASIRIPYVSNPKGRRIETRFPDPLMNPYLGFSALMMAGLDGVMNKIHPGEAADKNLYDLPPEEDAKIPTVCSSLDQALEYLDNDREFLTRGGVFSNSMLDAYIELKMEEVTRFRMTTHPIEFDMYYSL GT:EXON 1|1-471:0| BL:SWS:NREP 1 BL:SWS:REP 9->471|GLNA_AZOVI|0.0|68.3|463/467| PROS 52->70|PS00180|GLNA_1|PDOC00162| PROS 261->276|PS00181|GLNA_ATP|PDOC00162| PROS 388->400|PS00182|GLNA_ADENYLATION|PDOC00162| BL:PDB:NREP 1 BL:PDB:REP 4->471|1f1hA|0.0|64.1|468/468| RP:PDB:NREP 1 RP:PDB:REP 3->471|2bvcA|e-156|50.5|469/475| RP:PFM:NREP 2 RP:PFM:REP 18->96|PF03951|9e-14|47.4|78/80|Gln-synt_N| RP:PFM:REP 106->381|PF00120|2e-76|60.1|253/256|Gln-synt_C| HM:PFM:NREP 2 HM:PFM:REP 105->381|PF00120|1.1e-103|55.1|254/258|Gln-synt_C| HM:PFM:REP 16->97|PF03951|2e-32|52.4|82/84|Gln-synt_N| GO:PFM:NREP 5 GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF03951|IPR008147| GO:PFM GO:0006542|"GO:glutamine biosynthetic process"|PF03951|IPR008147| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF03951|IPR008147| GO:PFM GO:0004356|"GO:glutamate-ammonia ligase activity"|PF00120|IPR008146| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00120|IPR008146| RP:SCP:NREP 2 RP:SCP:REP 4->103|1f1hA1|2e-32|57.0|100/100|d.15.9.1| RP:SCP:REP 104->471|1f1hA2|e-158|66.0|368/368|d.128.1.1| HM:SCP:REP 4->104|1f52A1|3.2e-36|50.0|100/0|d.15.9.1|1/1|Glutamine synthetase, N-terminal domain| HM:SCP:REP 104->471|1f52A2|1.4e-135|47.3|368/0|d.128.1.1|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 1798 OP:NHOMOORG 946 OP:PATTERN 11-11123323333331121111111111112111111111112123121222111111111111-22 2233322322222324444-46223A444442A99934554433322222224323231123424243432222222211114111111111-1------------111---------------------------333332112411141111222111211111211221111111111112211121132111111-111111111221111111122311211111122111111111111111211111111221111111112211111111111111111111111111111111111111111111111111111131-11111111112-1111111111--11113115362132411-11--11-333122222124341113113133333333334-34133332386255545545557645111354555555711111111411131342211122211------------------13122311111145545422222443533332345211311111233111124214111141342111111111112211221121-21112-11111111111112211111111111111111111111111111221111212123433322222222223233---1123------13111112221211122-2222211222212222221222111111111111111111111422222221111111111111111-1-----222211353111111111-1111122232221114188889887989884455---------31112111111211122333334441111111-111111------------------------------------22122121111-- 111122--1---1121111144242311111-1111111111111122112233121222221--------------------------34113261111111112--11-1-11-----------1------------------------1-1--112---48---------11-1------114111112-1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 469 STR:RPRED 99.6 SQ:SECSTR ##ccHHHHHHHHHHTTccEEEEEEEcccccEEEEEEEGGGccHHHHHTcEEEETTccTTcccGGGcEEEEEEcGGGcEEcccccccEEEEEEEEEcTTTccccTTcHHHHHHHHHHHHHHHccccEEEEEEEEcEEEEcEEEEEEccccEEEEEEcTTcGGGTTcccccccccccccTTccccccTTTcccHHHHHHHHHHHHHTTccEEEEEEcccTTTEEEEEEccEEHHHHHHHHHHHHHHHHHHHHHTTcEEEccccccTTcccccEEEEEEEEETTEEcccTTcGGGccHHHHHHHHHHHHHHHHHHHHHcccTTHHHHccTTccccccccEEETcTTccEEEcccccTTcccEEEccccccccHHHHHHHHHHHHHHHHHTTccccccccccGGGccHHHHHTcccccccHHHHHHHHHHccHHHHGGGcccHHHHHHHHHHHHHTHHHHHTcccHHHHHHHTTc DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEHHHHcHHHccccccccccccccccccccccEEEEEEccccEEccccccccEEEEEEEEEccccEEccccHHHHHHHHHHHHHHccccccEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccEEEEEccccccEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHccHHHHHccHHHcccHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHccc //