[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08945.1
DDBJ      :             putative transmembrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  93/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:331 amino acids
:PSIPRED
:RPS:PFM   141->172 PF04116 * FA_hydroxylase 8e-04 50.0 %
:HMM:PFM   141->251 PF04116 * FA_hydroxylase 5.6e-24 33.3 111/114  
:BLT:SWISS 135->286 TM195_HUMAN 4e-06 27.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08945.1 GT:GENE ABF08945.1 GT:PRODUCT putative transmembrane protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2238598..2239593) GB:FROM 2238598 GB:TO 2239593 GB:DIRECTION - GB:PRODUCT putative transmembrane protein GB:PROTEIN_ID ABF08945.1 GB:DB_XREF GI:93354856 InterPro:IPR006087 LENGTH 331 SQ:AASEQ MWDALTNWLNLWVGQIEATVFQNVVLPVVYNLGFGGYAEDAFTGTEWLLVGLVQIAVMVLILGPLERLRPVEVVTDRAAIRTDILYTLIHRLGLFRLAMFFLLAPLMDGIEGHLRLLGWQRVNVEDWWPGVTSIPLISFSLYLALFDLLDYWYHRLSHTYRWWWSLHAVHHSQRQMTLWSDNRNHLLDDILRDFVFAAVALAVGVEPSQYVLLVALSQLLQSLQHANLRLHFGWLGERLLISPRFHRTHHAVGLGHEKRATAEKPARLGGCNYGVIFPWWDMLFGTADFTDVYHPTGIRDQMPPPAGRARSYGDGFLSQQWLGIKRLLRLG GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 135->286|TM195_HUMAN|4e-06|27.2|136/445| TM:NTM 4 TM:REGION 14->36| TM:REGION 44->66| TM:REGION 129->151| TM:REGION 194->216| SEG 194->205|fvfaavalavgv| SEG 208->224|sqyvllvalsqllqslq| RP:PFM:NREP 1 RP:PFM:REP 141->172|PF04116|8e-04|50.0|32/114|FA_hydroxylase| HM:PFM:NREP 1 HM:PFM:REP 141->251|PF04116|5.6e-24|33.3|111/114|FA_hydroxylase| GO:PFM:NREP 5 GO:PFM GO:0005506|"GO:iron ion binding"|PF04116|IPR006694| GO:PFM GO:0005783|"GO:endoplasmic reticulum"|PF04116|IPR006694| GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF04116|IPR006694| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF04116|IPR006694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF04116|IPR006694| OP:NHOMO 144 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------11-1--1------------------------2---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12----------------------1------1--11111--1---------------------------111-1-1-------------------------------2----111--2222222-22222322222223233223-1222-1211211-21--1----1-----------------------------1--1---------21--------------------------------31-1--1-2222211-1111----1-------------------------------------------------------------------------------------------------------------1--12-----------------------------------------------------------------111--------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHEEcccHHHHHHccccccccccccccccccccccccccHHHHccHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcc //