[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08946.1
DDBJ      :             polysaccharide deacetylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->170 2w3zA PDBj 2e-07 34.3 %
:RPS:PDB   75->269 2c1gA PDBj 1e-22 14.6 %
:RPS:SCOP  33->258 1ny1A  c.6.2.3 * 3e-31 25.1 %
:HMM:SCOP  22->270 2iw0A1 c.6.2.3 * 1.4e-36 25.3 %
:RPS:PFM   39->182 PF01522 * Polysacc_deac_1 1e-06 33.6 %
:HMM:PFM   34->184 PF01522 * Polysacc_deac_1 2e-23 30.5 118/124  
:BLT:SWISS 37->256 YFUM2_BACST 7e-09 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08946.1 GT:GENE ABF08946.1 GT:PRODUCT polysaccharide deacetylase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2239593..2240468) GB:FROM 2239593 GB:TO 2240468 GB:DIRECTION - GB:PRODUCT polysaccharide deacetylase GB:PROTEIN_ID ABF08946.1 GB:DB_XREF GI:93354857 InterPro:IPR002509 LENGTH 291 SQ:AASEQ MRNWMIRIGVAAAGLLASASLALASDASPGACRAGTLYLTFDTGSMSQAELIARTLRKHHIRATFFLANEPTVNHDNSLDPTWAAYWKSLAADGHAFGTHTFDHVYLRSAKGGEGGKVVMRPQFGAQGGKDVAMTEESFCTELRRSAQAFQSMTGQPMVPLWRAPGGHTSPKTLAWAEQCGFKHVGWAPAGFLGDELSSERYPNQMLLERALRDLRDGDITMAHLGIWSRKDPWAPGVLEPLISGLEQKGFCFATLREHPQYKHWIAQRGPVRVEQAGEQPQTSSVSGAKR GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 37->256|YFUM2_BACST|7e-09|28.2|181/265| SEG 11->31|aaagllasaslalasdaspga| BL:PDB:NREP 1 BL:PDB:REP 37->170|2w3zA|2e-07|34.3|108/238| RP:PDB:NREP 1 RP:PDB:REP 75->269|2c1gA|1e-22|14.6|157/384| RP:PFM:NREP 1 RP:PFM:REP 39->182|PF01522|1e-06|33.6|110/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 34->184|PF01522|2e-23|30.5|118/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 33->258|1ny1A|3e-31|25.1|187/235|c.6.2.3| HM:SCP:REP 22->270|2iw0A1|1.4e-36|25.3|217/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------1111-1111-1111111-11--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 82.5 SQ:SECSTR ###############################cccEEEEEEEEccccTTHHHHHHHHHHTTcccEEEEcHHHHHTEcGGGTTTcHHHHHHHHHTTcEEEEcccccccGGGcGGGccHHHHEcTTEEEEEEEccGccHHHHHHHHHHHHHHHHHHHccccccEEccGGGcccHHHHHHcccEEEcccEEccHHcGGHHHHGHHccHHHHHHHHHHHccTTEEEEEETTcccTTcHHHHHHHHHHHHHHHHTTcEEccHHHccTTcEEcccccH#################### DISOP:02AL 1-1,267-292| PSIPRED cccEEEEEEHHHHHHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEEccHHHHcccccccccHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEHHHcccHHHHHHcccccccccccccccccccccccc //