[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08947.1
DDBJ      :             40-residue YVTN beta-propeller repeat
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  176/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.69.2b.69.3
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->317 1l0qA PDBj 7e-22 29.0 %
:RPS:PDB   36->237 1e2rB PDBj 6e-09 11.5 %
:RPS:SCOP  31->319 1jmxB  b.69.2.2 * 9e-28 15.8 %
:HMM:SCOP  1->321 1qniA2 b.69.3.1 * 8.9e-72 32.4 %
:RPS:PFM   37->268 PF10282 * Muc_lac_enz 3e-21 33.9 %
:HMM:PFM   248->324 PF02239 * Cytochrom_D1 1.4e-06 21.9 73/369  
:HMM:PFM   39->257 PF10282 * Muc_lac_enz 4e-13 28.3 219/345  
:BLT:SWISS 31->114 YWHL_BACSU 7e-04 27.4 %
:BLT:SWISS 86->215 Y1604_STAES 1e-07 27.7 %
:TM
:REPEAT 5|31->71|73->113|131->157|159->199|201->241
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08947.1 GT:GENE ABF08947.1 GT:PRODUCT 40-residue YVTN beta-propeller repeat GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2240482..2241468) GB:FROM 2240482 GB:TO 2241468 GB:DIRECTION - GB:PRODUCT 40-residue YVTN beta-propeller repeat GB:PROTEIN_ID ABF08947.1 GB:DB_XREF GI:93354858 InterPro:IPR011964 LENGTH 328 SQ:AASEQ MLALRRVVAGAVSVGALALALVSAPARAEVVVILNSGDASVTLIDKDTQKVLETFPIGKEPHHLIATPDDKSLIVANAVGNDLVFLDPVTGKVQQRVPNIDDPYQIGFSPDQKWFIATGNRLDRVDVYRWDGRQLKIAKQFPLAKTPSHIAFTADSKIAFITLQDSNQIAAIDLTTLTVLWTMEAGSAPAGIWVTPDQKYLLVGMTGADYVAVIDWRTRTVVKQIQTGKGAHNFRAVGDKRHLFLSNRVSGSISIIDQQTLSKVGEITGLLPGPDDMELTADGKTLWVTFRWARSVGLIDVASRKMIKTIRVGKSPHGIYFRTRAPLY GT:EXON 1|1-328:0| BL:SWS:NREP 2 BL:SWS:REP 31->114|YWHL_BACSU|7e-04|27.4|84/458| BL:SWS:REP 86->215|Y1604_STAES|1e-07|27.7|130/342| TM:NTM 1 TM:REGION 9->31| NREPEAT 1 REPEAT 5|31->71|73->113|131->157|159->199|201->241| SEG 2->28|lalrrvvagavsvgalalalvsapara| BL:PDB:NREP 1 BL:PDB:REP 33->317|1l0qA|7e-22|29.0|276/385| RP:PDB:NREP 1 RP:PDB:REP 36->237|1e2rB|6e-09|11.5|192/543| RP:PFM:NREP 1 RP:PFM:REP 37->268|PF10282|3e-21|33.9|230/311|Muc_lac_enz| HM:PFM:NREP 2 HM:PFM:REP 248->324|PF02239|1.4e-06|21.9|73/369|Cytochrom_D1| HM:PFM:REP 39->257|PF10282|4e-13|28.3|219/345|Muc_lac_enz| RP:SCP:NREP 1 RP:SCP:REP 31->319|1jmxB|9e-28|15.8|284/339|b.69.2.2| HM:SCP:REP 1->321|1qniA2|8.9e-72|32.4|315/0|b.69.3.1|1/1|Nitrous oxide reductase, N-terminal domain| OP:NHOMO 300 OP:NHOMOORG 180 OP:PATTERN --------------------------------------------------789--------------- 145-3------------11-11----11111--111---1-221------------------11--12----------------------------------------11--------------------------------------------------------111-------------------------------1-1------------2-1-2--------------------------------------------------------------------------------------------------------111-------11-11-11--------------21--------11-----2------------4222-------1----------1-5424634611--------1---11-4---2-111112-21111111111113-----------------------------------1--1211-11111111111111211111122123321122142122133-32--1-212----------2--11-1--------------1---13------11-1---------------------------------1-1--------------------1------1------------------------------------------------------------------------------------------------------2-----------------------------1-----21111233211-1---------1----------------11111----------------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 89.3 SQ:SECSTR ############################TEEEEEEHHHHHHHHHHHHTHHHHcTTcEHHTTcccccccccHHHHHHHcHHHHHHHHHHccTTTcccHHHHccccHHHHHHHHHHHccccccEcccEccHHHHHHHcEEcccGGGcccccccccGGGEEEEEEEGGGTEEEEEETTTccEEEEEEccccEEEEEEcTTccEEEEEcETTcEEEEEETTcccccEEEEEEcccEEEEEEEcTTccEEEEEcccEEEETTccccccccccccccccEEEEEEcTTTccEEEETcccEEEEEEEcTTccEEEEEEEEEcEEEEEE####### DISOP:02AL 1-2| PSIPRED ccHHHEHHcccEEHHHHHEEEEcccccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEcccccEEEEEEccccEEEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccc //