[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08950.1
DDBJ      :             Fe(II) trafficking protein YggX
Swiss-Prot:FETP_RALME   RecName: Full=Probable Fe(2+)-trafficking protein;

Homologs  Archaea  0/68 : Bacteria  311/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.279.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->110 1yhdA PDBj 5e-18 44.2 %
:RPS:SCOP  25->100 1t07A  d.279.1.1 * 1e-32 46.1 %
:HMM:SCOP  24->114 1xs8A_ d.279.1.1 * 2.7e-39 65.9 %
:RPS:PFM   24->110 PF04362 * Iron_traffic 4e-33 69.0 %
:HMM:PFM   24->111 PF04362 * Iron_traffic 1.3e-44 64.8 88/88  
:BLT:SWISS 24->114 FETP_RALME 1e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08950.1 GT:GENE ABF08950.1 GT:PRODUCT Fe(II) trafficking protein YggX GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2247042..2247386 GB:FROM 2247042 GB:TO 2247386 GB:DIRECTION + GB:PRODUCT Fe(II) trafficking protein YggX GB:PROTEIN_ID ABF08950.1 GB:DB_XREF GI:93354861 InterPro:IPR007457 LENGTH 114 SQ:AASEQ MGGYSRPAGQLGYNSGQTNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQTMLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA GT:EXON 1|1-114:0| SW:ID FETP_RALME SW:DE RecName: Full=Probable Fe(2+)-trafficking protein; SW:GN OrderedLocusNames=Rmet_2071; SW:KW Complete proteome; Iron. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 24->114|FETP_RALME|1e-52|100.0|91/91| BL:PDB:NREP 1 BL:PDB:REP 25->110|1yhdA|5e-18|44.2|86/92| RP:PFM:NREP 1 RP:PFM:REP 24->110|PF04362|4e-33|69.0|87/88|Iron_traffic| HM:PFM:NREP 1 HM:PFM:REP 24->111|PF04362|1.3e-44|64.8|88/88|Iron_traffic| GO:PFM:NREP 1 GO:PFM GO:0005506|"GO:iron ion binding"|PF04362|IPR007457| RP:SCP:NREP 1 RP:SCP:REP 25->100|1t07A|1e-32|46.1|76/81|d.279.1.1| HM:SCP:REP 24->114|1xs8A_|2.7e-39|65.9|91/0|d.279.1.1|1/1|YggX-like| OP:NHOMO 311 OP:NHOMOORG 311 OP:PATTERN -------------------------------------------------------------------- 111-------------------------------------------------------------------------------------------------------------------------------------11111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111-11------------------------1111-1---------------------------111111111111111111111111111111111--11111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 76.3 SQ:SECSTR #######################ccccEEccccccEEcccccccccTTHHHHHHHHccHHHHHHHHHHHHHHHHHTTccTTcHHHHHHHHHHHHHHTTTTTccccccccc#### DISOP:02AL 1-6,8-8,112-115| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccc //