[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08951.1
DDBJ      :             major facilitator superfamily MFS_1
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  265/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:427 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  27->354 1pv6A  f.38.1.2 * 3e-11 17.9 %
:HMM:SCOP  1->422 1pw4A_ f.38.1.1 * 3.5e-67 25.7 %
:RPS:PFM   46->285 PF07690 * MFS_1 1e-10 27.6 %
:HMM:PFM   28->377 PF07690 * MFS_1 2.3e-42 24.9 334/353  
:BLT:SWISS 15->282 NASA_BACSU 8e-35 32.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08951.1 GT:GENE ABF08951.1 GT:PRODUCT major facilitator superfamily MFS_1 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2247655..2248938 GB:FROM 2247655 GB:TO 2248938 GB:DIRECTION + GB:PRODUCT major facilitator superfamily MFS_1 GB:PROTEIN_ID ABF08951.1 GB:DB_XREF GI:93354862 InterPro:IPR007114 InterPro:IPR011701 LENGTH 427 SQ:AASEQ MATPNLPSSKPEPVSSGAWTTLWSSTFAFTICFAVWMLFAVLGIPLKKELGLNDTEFGLLAATPVLSGSLIRVPLGIWTDRYGGRIVFFVLMLLTVIPIWLISYAHTLWQLLVLGLFVGLAGGSFSVGTPYVARWFPRSRQGLAMGIFGAGNSGAALTKFVAPALILAAGTWEIVPRVYSVAMLITAIVFWLFSRSNPAHRVSSATSWRAQLAVMRDPRVWRYSQYYSVVFGGYVGLSLWMTKYYIGEYGFDMKTAAFLAACFSLPGGVLRAIGGWISDRYGAHRTTWWVMWVSWVTFFLLSYPRSDFTIHTANGPESFHIALSPTVFTILMFVVGIAFAVGKASVFKFISNDFTHNIGAVSGVVGLAGGLGGFILPILFGALADLTGIRTSCFMLMYGAVCVSLVWMHYSQRAANARPTPETLQAA GT:EXON 1|1-427:0| BL:SWS:NREP 1 BL:SWS:REP 15->282|NASA_BACSU|8e-35|32.8|265/401| TM:NTM 8 TM:REGION 25->46| TM:REGION 82->104| TM:REGION 106->128| TM:REGION 164->186| TM:REGION 283->303| TM:REGION 320->342| TM:REGION 356->378| TM:REGION 389->411| SEG 111->126|llvlglfvglaggsfs| SEG 286->297|ttwwvmwvswvt| SEG 358->383|igavsgvvglagglggfilpilfgal| RP:PFM:NREP 1 RP:PFM:REP 46->285|PF07690|1e-10|27.6|239/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 28->377|PF07690|2.3e-42|24.9|334/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 27->354|1pv6A|3e-11|17.9|308/417|f.38.1.2| HM:SCP:REP 1->422|1pw4A_|3.5e-67|25.7|404/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 329 OP:NHOMOORG 271 OP:PATTERN ------1--11-------------1---2--1------------------------------------ --1---11111------11-11---111111-1111---------11-------1-----21111---11----------1-11-1---------------1---111------------------------------------1-311-11-----1111111-----11------------11--------2111111-111111112122-2111-21----------1-1111111111111111111--------1---11-1----------------------------------------------------------------------------------------1-------------------2114-----12---322-1---1111-11-111-113113131-------111111111--11--2-------111111111---1----------------------------------111-----22----2111111111222212-111121--1211211112211-1-111112-----------212------------------21-----------------------------------11-----2111-1-1-----1-1------11-32----1-------------1--------------------------------1--------------------------------1--------------1-----222-1222-----------------------1-21-22221-11111111111----------1--1-------1--11-1111-----------11--------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19,198-212,414-428| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccc //