[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08954.1
DDBJ      :             respiratory nitrate reductase beta subunit
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  439/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:517 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->472 1siwB PDBj 0.0 74.2 %
:RPS:PDB   178->254 1bc6A PDBj 3e-16 21.3 %
:RPS:SCOP  1->501 1q16B  d.58.1.5 * 6e-40 65.3 %
:HMM:SCOP  1->508 1q16B_ d.58.1.5 * 1.4e-189 45.1 %
:HMM:PFM   10->26 PF00037 * Fer4 3.1e-05 47.1 17/24  
:BLT:SWISS 1->472 NARH_ECOLI 0.0 74.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08954.1 GT:GENE ABF08954.1 GT:PRODUCT respiratory nitrate reductase beta subunit GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2254147..2255700 GB:FROM 2254147 GB:TO 2255700 GB:DIRECTION + GB:PRODUCT respiratory nitrate reductase beta subunit GB:PROTEIN_ID ABF08954.1 GB:DB_XREF GI:93354865 InterPro:IPR001450 InterPro:IPR006547 LENGTH 517 SQ:AASEQ MKIRAQVAMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGVGFPKEWENQDKWQGGWKRNADGSLTPRQGGKTKILANIFANPNLPQIDDYYEPFTFDYEHLQNAPLMQTPPTARPVSAITGKKMEKIEWGPNWEDDLGGEFDQRSRDKLFEDIQKDMYSTFENTFMMYLPRLCEHCLNPTCVASCPSGSVYKREEDGIVLVDQDKCRGWRMCVSGCPYKKIYFNWQTGKAEKCVFCYPRIEAGQPTVCSETCVGRIRYLGVMLYDADRIEQAASVADERDLYQSQLDVFLDPHDPKIQAEALRQGIPQSWLDAAVKSPVYKMACEWKVAFPLHPEYRTLPMVWYIPPLSPIQSAAESGFMGMNGVIPDVKSLRIPVKYLANLLTAGDVNPVLSALERMLAMRAYKRSESVDGLQDLAVLEQVGLTPAQVEDMYQIMAIANYEDRFVVPSSHKEMAEDSFDEKGSCGFSFGNGCSGGTSDGSLFGTKKPKPEVSYADLPRSRRKAITG GT:EXON 1|1-517:0| BL:SWS:NREP 1 BL:SWS:REP 1->472|NARH_ECOLI|0.0|74.2|472/512| SEG 473->486|gscgfsfgngcsgg| BL:PDB:NREP 1 BL:PDB:REP 1->472|1siwB|0.0|74.2|472/508| RP:PDB:NREP 1 RP:PDB:REP 178->254|1bc6A|3e-16|21.3|75/77| HM:PFM:NREP 1 HM:PFM:REP 10->26|PF00037|3.1e-05|47.1|17/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->501|1q16B|6e-40|65.3|501/509|d.58.1.5| HM:SCP:REP 1->508|1q16B_|1.4e-189|45.1|508/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 1696 OP:NHOMOORG 481 OP:PATTERN 22-2-221344333323-3354463113-112-----111111--------------313----1--- -5711-11111--1-2211-11--1211111-12221-111---11211-----1-----2122112-3----------4aP334222-------------------------------------2243333332311111222-3----------------------------------------1-1----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1--------------------------------------------------------21--1111111-1-12-----------7----lh1132-378---1----511--1------1---222--1--11111111112---2--1-2-1-------------121-11112-1--2-1111111113----4-------------------------------------111-22112122333333234444132222131--121-21223112112-14---23----------713-5342595485448146476651-7686-232-32----11-----------161321142-111-----33664-4D787466985H6----542------948576-9AA99A89A9-A99A999999AA999999566654219DBCCDDDDDDCBDBCD56879899--333333333333---1---------1111-444434133232114-------1-12-22221-1--11114-------------1222-----3311222------------123------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 472 STR:RPRED 91.3 SQ:SECSTR ccEEEEEEEEEETTTcccccHHHHHHHHHHcccTTcTTccccEEEEEcccTTTTTTTcHHHHcccEEEcTTccEEETTccHHHHHTTTTccTTcccHHHHcccEEEcTHHHHHcccccccccccEEETTTcccccccHHHHHHHHHHcTTcTTTHHHHHHHHHHHHHTTcGccccccEcccTTTTccccccTTTcTTccEEEEEccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTTccccccccccccTTHHHHHcHHHHHHHHHHHHHHHHccTTccHHHHHHHHcHHHHHHHHTccccGGGccccTTccGGGGGccccccccTcHHHHHHHHHHHHcTTTTccccccccccTTccccHHHHHHHHHHHTTccEEEEcccTTHHHHHHHHHHHTTcTTTcEEEEEEEEcccTTHTccHHHHHHHHHHHTTccHHHHEEcccccTTTTccHHHHH############################################# DISOP:02AL 1-4,412-424,513-518| PSIPRED cccEEEEEEEEEccccccccEEEEEEcccccccccccEEEEEEccccccccccccccccccccccEEEccccccccccccHHHHHHHHHcccccccHHHccccccccHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEEEEEEcccccEEEEEHHHcccccccHHHHHcccccEEEcccccEEEEcHHHHccHHHHHHHcccccEEEcccccEEEEccccHHHHHcccccEEHHHcccccEEEEcccccccHHHHHHHHccccccHHHccccccccccccHHHHHHHccccHHHcccHHcccHHHHHHHccccccccHHHcccccEEEEccccHHHHHHHHcccccccccccHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHccc //