[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08958.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.3.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->102 1n15A PDBj 3e-04 35.6 %
:RPS:PDB   59->120 3dr0A PDBj 1e-07 8.3 %
:RPS:SCOP  57->127 1h1oA1  a.3.1.4 * 4e-07 16.9 %
:HMM:SCOP  16->120 2mtaC_ a.3.1.1 * 1.9e-15 31.7 %
:HMM:PFM   52->112 PF00034 * Cytochrom_C 7.2e-06 26.7 60/91  
:HMM:PFM   41->60 PF09256 * BaffR-Tall_bind 0.00045 55.0 20/31  
:BLT:SWISS 45->118 NIRC_PARDP 2e-22 56.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08958.1 GT:GENE ABF08958.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2257848..2258237 GB:FROM 2257848 GB:TO 2258237 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF08958.1 GB:DB_XREF GI:93354869 InterPro:IPR009056 LENGTH 129 SQ:AASEQ MMSAFAPLAGEPMPTLRWICIPILSCIAATAIAAEPPAAAPTPARQAELFRLLRDDCGACHGMTLQGGLGSPLTAAALADKPRDGLVATVLQGRPGTAMPPWRPFMTQDEARWLIDRLQSGQVPAVPKP GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 45->118|NIRC_PARDP|2e-22|56.8|74/103| TM:NTM 1 TM:REGION 7->29| SEG 27->44|iaataiaaeppaaaptpa| BL:PDB:NREP 1 BL:PDB:REP 57->102|1n15A|3e-04|35.6|45/538| RP:PDB:NREP 1 RP:PDB:REP 59->120|3dr0A|1e-07|8.3|60/93| HM:PFM:NREP 2 HM:PFM:REP 52->112|PF00034|7.2e-06|26.7|60/91|Cytochrom_C| HM:PFM:REP 41->60|PF09256|0.00045|55.0|20/31|BaffR-Tall_bind| RP:SCP:NREP 1 RP:SCP:REP 57->127|1h1oA1|4e-07|16.9|71/82|a.3.1.4| HM:SCP:REP 16->120|2mtaC_|1.9e-15|31.7|104/147|a.3.1.1|1/1|Cytochrome c| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----1-1-------------1-----------------------------------------1------------------------1111-----1--11--------11-----------------1----------------------------------------------------1---1--------1--------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1111---------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 61.2 SQ:SECSTR ##################################################HHHHTTHHTTccccHHHHHHHcTTTTTTcccHHHHHHHHHHHccTHHTcccccTTccHHHHHHHHHHHHHTccccccEE DISOP:02AL 1-7,123-130| PSIPRED ccccccccccccccccEEcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccc //