[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08967.1
DDBJ      :             ribose-5-phosphate isomerase
Swiss-Prot:RPIA_RALEJ   RecName: Full=Ribose-5-phosphate isomerase A;         EC=5.3.1.6;AltName: Full=Phosphoriboisomerase A;         Short=PRI;

Homologs  Archaea  64/68 : Bacteria  592/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.124.1d.58.40
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->224 3enqA PDBj 1e-57 55.6 %
:RPS:PDB   12->212 3dlxC PDBj 3e-28 9.7 %
:RPS:SCOP  2->49 2gnpA1  c.124.1.8 * 6e-05 18.8 %
:RPS:SCOP  53->142 1o8bA1  c.124.1.4 * 5e-30 48.8 %
:RPS:SCOP  131->207 1ks2A2  d.58.40.1 * 2e-21 55.6 %
:HMM:SCOP  1->152 1m0sA1 c.124.1.4 * 3.4e-41 48.6 %
:HMM:SCOP  131->205 1uj6A2 d.58.40.1 * 3.6e-23 54.1 %
:RPS:PFM   54->223 PF06026 * Rib_5-P_isom_A 3e-35 51.5 %
:HMM:PFM   53->223 PF06026 * Rib_5-P_isom_A 6.1e-65 49.1 169/173  
:HMM:PFM   5->45 PF04198 * Sugar-bind 9.3e-06 26.8 41/255  
:BLT:SWISS 1->228 RPIA_RALEJ e-108 91.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08967.1 GT:GENE ABF08967.1 GT:PRODUCT ribose-5-phosphate isomerase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2267396..2268082) GB:FROM 2267396 GB:TO 2268082 GB:DIRECTION - GB:PRODUCT ribose-5-phosphate isomerase GB:PROTEIN_ID ABF08967.1 GB:DB_XREF GI:93354878 InterPro:IPR004788 LENGTH 228 SQ:AASEQ MTQDELKALVAQAAADYVKQEVPEGAVLGVGTGSTANLFIDAVAAFKERFSGAVSSSEASTRRLQQHGFNVLDLNEVDSIPVYVDGADEIDNSGAMIKGGGGALTREKIVASVADRFVCIADGSKLVPTMGAFPLPVEVIPMARAAVARSLAALGGQPRLRMTKEGGIYKTDNGNVILDVSGLKIENPKALEQQINQLPGVVTVGLFALRGANVLLLGTEQGVQRSDY GT:EXON 1|1-228:0| SW:ID RPIA_RALEJ SW:DE RecName: Full=Ribose-5-phosphate isomerase A; EC=5.3.1.6;AltName: Full=Phosphoriboisomerase A; Short=PRI; SW:GN Name=rpiA; OrderedLocusNames=Reut_A2068; SW:KW Complete proteome; Isomerase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->228|RPIA_RALEJ|e-108|91.7|228/228| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| SEG 143->154|araavarslaal| BL:PDB:NREP 1 BL:PDB:REP 2->224|3enqA|1e-57|55.6|214/217| RP:PDB:NREP 1 RP:PDB:REP 12->212|3dlxC|3e-28|9.7|185/467| RP:PFM:NREP 1 RP:PFM:REP 54->223|PF06026|3e-35|51.5|169/173|Rib_5-P_isom_A| HM:PFM:NREP 2 HM:PFM:REP 53->223|PF06026|6.1e-65|49.1|169/173|Rib_5-P_isom_A| HM:PFM:REP 5->45|PF04198|9.3e-06|26.8|41/255|Sugar-bind| GO:PFM:NREP 2 GO:PFM GO:0004751|"GO:ribose-5-phosphate isomerase activity"|PF06026|IPR004788| GO:PFM GO:0009052|"GO:pentose-phosphate shunt, non-oxidative branch"|PF06026|IPR004788| RP:SCP:NREP 3 RP:SCP:REP 2->49|2gnpA1|6e-05|18.8|48/262|c.124.1.8| RP:SCP:REP 53->142|1o8bA1|5e-30|48.8|86/96|c.124.1.4| RP:SCP:REP 131->207|1ks2A2|2e-21|55.6|72/72|d.58.40.1| HM:SCP:REP 1->152|1m0sA1|3.4e-41|48.6|148/148|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| HM:SCP:REP 131->205|1uj6A2|3.6e-23|54.1|74/0|d.58.40.1|1/1|D-ribose-5-phosphate isomerase (RpiA), lid domain| OP:NHOMO 901 OP:NHOMOORG 831 OP:PATTERN 11111-111111111-11111111111-1111111111111111111111111111111111111-11 --------------------------------------11-------------------------------1111111----1-----111--1-----------2-11-111111111111111-----------11111----1111111111111111111111111111111111111111111---1--11111111-1111111-----111----21-111111-1-11111111111111111111111121211122111111123211111111111111111111111111111111111111111111111---12------------------------------------------------11111111111111111111111111-111111-1111111111111111111111111111111111111111111111111111------------------------------------1-11111111111111111111111111111111211111111111111111111322111111111111111-1-------1------------------11---------------------------111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111--1---1111111111111111122222222212111111111111111111111111111111111111111111121111111111111111111111111111111111111112111111111111111111--------1111111111--------------------------------------- ----111-----11111111111111111111111--111111111111111111111111111111111111211111-11111111-13111111111111321111-212-12211121111111-121-11111-111111-11--1-111111111-11111111411111111811111423713212211-2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 99.6 SQ:SECSTR cTccHHHHHHHTTHHHHHGGGccTTccEEEEETTTEEEEcccccccTTcccTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTcTcccccTTHccHHHHTccTTcEEEEEcccccGGGcccccEEccccccccccccccEEEcccEEEEEEcccccccHHTTTEEEEEEEcccTTccHHHHHTTcccccEEEEEEEEcccccHHHHcccTTccEEEc# DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHcccEEEEHHHcccccEEEEcHHHccccccEEEccHHHHHHHHHHHHcccEEEEEEEcccccccccccccEEEEEEHHHHHHHHHHHHcccEEEEEEcccccEEEcccccEEEEEEccccccHHHHHHHHHccccEEEccEEEcccccEEEEEccccEEEccc //