[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08972.1
DDBJ      :             transcriptional regulator, BadM/Rrf2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  202/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->132 1xd7A PDBj 2e-16 40.9 %
:RPS:PDB   13->68 2acjC PDBj 3e-04 19.6 %
:RPS:SCOP  11->98 1f6vA  a.49.1.1 * 3e-08 9.6 %
:HMM:SCOP  5->133 1xd7A_ a.4.5.55 * 6e-34 35.4 %
:RPS:PFM   1->80 PF02082 * Rrf2 1e-08 33.8 %
:HMM:PFM   1->80 PF02082 * Rrf2 8.8e-24 38.8 80/83  
:HMM:PFM   43->140 PF05977 * DUF894 0.00022 23.5 98/524  
:BLT:SWISS 4->135 YWNA_BACSU 2e-18 38.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08972.1 GT:GENE ABF08972.1 GT:PRODUCT transcriptional regulator, BadM/Rrf2 family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2273795..2274229 GB:FROM 2273795 GB:TO 2274229 GB:DIRECTION + GB:PRODUCT transcriptional regulator, BadM/Rrf2 family GB:PROTEIN_ID ABF08972.1 GB:DB_XREF GI:93354883 InterPro:IPR000944 LENGTH 144 SQ:AASEQ MSTSSRFAVAVHILTLLAQAEGPVPSSMIAGSVGTNPALIRRMIGALTEAGFVTTTMGSTGGAMLTRPASQITLLEVFQATETTALITLHQSAPNPACLVGREITGTLQVVADRAQAAMDATLAEITIASMLGEVEHAARRRKR GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 4->135|YWNA_BACSU|2e-18|38.8|129/133| BL:PDB:NREP 1 BL:PDB:REP 5->132|1xd7A|2e-16|40.9|115/116| RP:PDB:NREP 1 RP:PDB:REP 13->68|2acjC|3e-04|19.6|56/66| RP:PFM:NREP 1 RP:PFM:REP 1->80|PF02082|1e-08|33.8|80/83|Rrf2| HM:PFM:NREP 2 HM:PFM:REP 1->80|PF02082|8.8e-24|38.8|80/83|Rrf2| HM:PFM:REP 43->140|PF05977|0.00022|23.5|98/524|DUF894| RP:SCP:NREP 1 RP:SCP:REP 11->98|1f6vA|3e-08|9.6|83/91|a.49.1.1| HM:SCP:REP 5->133|1xd7A_|6e-34|35.4|127/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 263 OP:NHOMOORG 202 OP:PATTERN -------------------------------------------------------------------- 1------------------------------------111-------------2------------2-1------112---2-------------------1-----1------------------------------------1--------------------------------------21--------222222222122222211222122212-1-1-11111123---------------1----1-21--12--111----111-1-----------1--11111111111-------------123111333------1111111-1-------------------11---------------1-11----------1------1-11----------1-11-11-11--1-111----111-1---1-111---11--------------11----------------------------------1------12123221222211122212122111112----1--1--1---1--1----------------------------------------------1-11---11-----------------------------1-1-----------1--------------------------1-11------------------------------111--11-----------------1------------------------------------2-1--------------------------11111---1------1--------------------------11-1111----------2--1111--------2--------------------1-----------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 81.9 SQ:SECSTR ###ccHHHHHTTHHHHHHcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccccEEEEcccGGGccHHHHHHHHc###########cccccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHc############ DISOP:02AL 1-2,135-145| PSIPRED ccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccc //