[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08989.1
DDBJ      :             nucleoside diphosphate kinase
Swiss-Prot:NDK_RALME    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  65/68 : Bacteria  798/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->140 1nhkL PDBj 9e-49 63.3 %
:RPS:PDB   4->139 2cwkB PDBj 5e-52 46.3 %
:RPS:SCOP  1->141 1b4sA  d.58.6.1 * 6e-50 38.3 %
:HMM:SCOP  1->140 1w7wA_ d.58.6.1 * 1.2e-53 53.6 %
:RPS:PFM   4->134 PF00334 * NDK 4e-43 61.8 %
:HMM:PFM   4->135 PF00334 * NDK 7.2e-57 53.8 132/135  
:BLT:SWISS 1->141 NDK_RALME 1e-76 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08989.1 GT:GENE ABF08989.1 GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2292036..2292461) GB:FROM 2292036 GB:TO 2292461 GB:DIRECTION - GB:PRODUCT nucleoside diphosphate kinase GB:PROTEIN_ID ABF08989.1 GB:DB_XREF GI:93354900 InterPro:IPR001564 LENGTH 141 SQ:AASEQ MAIERTLSIIKPDAVAKNVIGQIYARFEAAGLKVVAAKMVHLSRGEAEQFYAVHKARPFFKDLVDFMVSGPVMIQALEGESAIAKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETAAVEVAFFFPGMNVYSR GT:EXON 1|1-141:0| SW:ID NDK_RALME SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=Rmet_2110; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->141|NDK_RALME|1e-76|100.0|141/141| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 2->140|1nhkL|9e-49|63.3|139/143| RP:PDB:NREP 1 RP:PDB:REP 4->139|2cwkB|5e-52|46.3|136/152| RP:PFM:NREP 1 RP:PFM:REP 4->134|PF00334|4e-43|61.8|131/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 4->135|PF00334|7.2e-57|53.8|132/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->141|1b4sA|6e-50|38.3|141/150|d.58.6.1| HM:SCP:REP 1->140|1w7wA_|1.2e-53|53.6|140/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1660 OP:NHOMOORG 1058 OP:PATTERN 11-1111111111111-11111111111111111111111111111111111111111111111-111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 1122434-51124451111111111111111111111111111111-1111111-111111111111111111111111111111111-111111122211135431384C8A99BA6465393BE5F7ccF-F8G4547E55DB46742725D4947799645581323811742443O22232A5881593434333 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 141 STR:RPRED 100.0 SQ:SECSTR cTTEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGcccc DISOP:02AL 1-1,141-142| PSIPRED cccEEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccEEccccccccccEEEccccHHHHHHHHHHHccHHHcccc //