[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF08994.1
DDBJ      :             sigma 28 (Flagella/Sporulation)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  908/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->374 3dxjF PDBj 1e-48 43.9 %
:RPS:PDB   112->383 3dxjF PDBj 1e-40 41.3 %
:RPS:SCOP  115->217 1sigA  a.177.1.1 * 2e-30 48.5 %
:RPS:SCOP  221->281 1iw7F1  a.4.13.1 * 2e-11 30.5 %
:RPS:SCOP  320->376 1ku3A  a.4.13.2 * 3e-12 45.6 %
:HMM:SCOP  111->220 1ku2A2 a.177.1.1 * 5.9e-44 60.9 %
:HMM:SCOP  223->299 1rp3A1 a.4.13.1 * 3.5e-12 42.7 %
:HMM:SCOP  282->386 1iw7F2 a.4.13.2 * 9.8e-24 39.0 %
:RPS:PFM   150->201 PF04542 * Sigma70_r2 9e-10 50.0 %
:RPS:PFM   229->305 PF04539 * Sigma70_r3 2e-06 37.3 %
:RPS:PFM   321->372 PF04545 * Sigma70_r4 4e-07 60.4 %
:HMM:PFM   150->220 PF04542 * Sigma70_r2 8.7e-24 38.0 71/71  
:HMM:PFM   320->373 PF04545 * Sigma70_r4 4.7e-19 54.0 50/50  
:HMM:PFM   230->307 PF04539 * Sigma70_r3 7.9e-16 34.2 76/78  
:HMM:PFM   112->147 PF00140 * Sigma70_r1_2 8.4e-10 41.7 36/37  
:BLT:SWISS 111->385 RPOS_YEREN 3e-75 53.5 %
:PROS 174->187|PS00715|SIGMA70_1
:PROS 345->371|PS00716|SIGMA70_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF08994.1 GT:GENE ABF08994.1 GT:PRODUCT sigma 28 (Flagella/Sporulation) GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2296755..2297915) GB:FROM 2296755 GB:TO 2297915 GB:DIRECTION - GB:PRODUCT sigma 28 (Flagella/Sporulation) GB:PROTEIN_ID ABF08994.1 GB:DB_XREF GI:93354905 InterPro:IPR000943 InterPro:IPR007624 InterPro:IPR007627 InterPro:IPR007630 InterPro:IPR009042 InterPro:IPR012761 LENGTH 386 SQ:AASEQ MPRQKTVSSGVVSRTRRPKQPEGKAGVARPDGGIDTEMFGDDPAAELVPVADEPIAPVSRVGLRNTDLNADDADHDDGDEEESEEDEEEGSSETTAEPDDFRTVLHTELAADTVQHYLNRISIKPLLSAPEELHFSTLAKGGDFSARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPSRGFRFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKGGTDGRDASLEDIAHLLGKTPDEVQDVLALNEHTTSLDTPFDLDPGSSLLDFLSDEHNAAPDQEVAHRELENLMKLWLARLSEKHRYVVERRFGLNHIEPATLEELAEEMGLTRERVRQIQQEALVKLKRHFASQGVRKDAVL GT:EXON 1|1-386:0| BL:SWS:NREP 1 BL:SWS:REP 111->385|RPOS_YEREN|3e-75|53.5|273/331| PROS 174->187|PS00715|SIGMA70_1|PDOC00592| PROS 345->371|PS00716|SIGMA70_2|PDOC00592| SEG 70->97|addadhddgdeeeseedeeegssettae| BL:PDB:NREP 1 BL:PDB:REP 126->374|3dxjF|1e-48|43.9|246/349| RP:PDB:NREP 1 RP:PDB:REP 112->383|3dxjF|1e-40|41.3|269/349| RP:PFM:NREP 3 RP:PFM:REP 150->201|PF04542|9e-10|50.0|52/70|Sigma70_r2| RP:PFM:REP 229->305|PF04539|2e-06|37.3|75/78|Sigma70_r3| RP:PFM:REP 321->372|PF04545|4e-07|60.4|48/49|Sigma70_r4| HM:PFM:NREP 4 HM:PFM:REP 150->220|PF04542|8.7e-24|38.0|71/71|Sigma70_r2| HM:PFM:REP 320->373|PF04545|4.7e-19|54.0|50/50|Sigma70_r4| HM:PFM:REP 230->307|PF04539|7.9e-16|34.2|76/78|Sigma70_r3| HM:PFM:REP 112->147|PF00140|8.4e-10|41.7|36/37|Sigma70_r1_2| GO:PFM:NREP 15 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF04539|IPR007624| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04539|IPR007624| GO:PFM GO:0006352|"GO:transcription initiation"|PF04539|IPR007624| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04539|IPR007624| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04539|IPR007624| GO:PFM GO:0003677|"GO:DNA binding"|PF04545|IPR007630| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04545|IPR007630| GO:PFM GO:0006352|"GO:transcription initiation"|PF04545|IPR007630| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04545|IPR007630| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04545|IPR007630| RP:SCP:NREP 3 RP:SCP:REP 115->217|1sigA|2e-30|48.5|103/305|a.177.1.1| RP:SCP:REP 221->281|1iw7F1|2e-11|30.5|59/61|a.4.13.1| RP:SCP:REP 320->376|1ku3A|3e-12|45.6|57/61|a.4.13.2| HM:SCP:REP 111->220|1ku2A2|5.9e-44|60.9|110/0|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 223->299|1rp3A1|3.5e-12|42.7|75/0|a.4.13.1|1/2|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 282->386|1iw7F2|9.8e-24|39.0|105/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 2775 OP:NHOMOORG 931 OP:PATTERN -------------------------------------------------------------------- 1124622222222233322-24222322222223334465433421113322121111113372764ABA41111111211382244411111111111111112211142222222222111111-1111111115555611155T8866665677666878665789A757555557555532-1111256755555556555556567666655567736222222228611111111111111122211111211211111111111111111111111111111111111111111111111111111111111111156666665667657557555555765325547555465646656665112336222433333224222232223233333333333-33334333333232233333333322233333444433322222222222223432222222222222212222222222222222232322222555565344545544444434556454422443232223224324333232342222222333334333243333323332445444345556557231111111111111111111111111554434443433343333343333443333332-2544422222232334334445444444-44444343444443443343333344324333333343333334324324422333333333333223233333444422334222222222222222222222222244444443463444433332222222223444444444545442222222222222222442222222222222242111111-11111111111111111112131111111331 -------1----------------------------------------------------------------------------------------------------4-------------------------------------------------1----------------4212K122436689-64861---6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 71.5 SQ:SECSTR ###########################################################################################################HHHHccTTTHHHHHHHHHHTccHHHHHHHHHHHHEHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHTHHcccccHHHHHHHHcTTccHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHTTTTccTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTTcccGGG### DISOP:02AL 1-30,74-101| PSIPRED ccccHHHHHHHHHHcccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHccccEEEEcccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //