[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09001.1
DDBJ      :             extracellular solute-binding protein, family 3
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  133/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   120->205 3e4rA PDBj 8e-06 35.8 %
:RPS:PDB   38->342 2de3B PDBj 1e-20 13.7 %
:RPS:SCOP  35->269 1us4A  c.94.1.1 * 4e-21 17.9 %
:HMM:SCOP  34->288 1us5A_ c.94.1.1 * 2.9e-45 29.3 %
:RPS:PFM   64->262 PF09084 * NMT1 6e-20 34.9 %
:HMM:PFM   50->264 PF09084 * NMT1 5.2e-30 27.5 207/216  
:BLT:SWISS 24->304 YTLA_BACSU 2e-12 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09001.1 GT:GENE ABF09001.1 GT:PRODUCT extracellular solute-binding protein, family 3 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2303523..2304566) GB:FROM 2303523 GB:TO 2304566 GB:DIRECTION - GB:PRODUCT extracellular solute-binding protein, family 3 GB:PROTEIN_ID ABF09001.1 GB:DB_XREF GI:93354912 InterPro:IPR001638 LENGTH 347 SQ:AASEQ MYNKKFWKQVLIALALFLAGWFTFGSAQAQGKPEKSKVTIAVGGKNLFYYLPLTIAERLGYFKEEGLDVEIVDFAGGAKALQAVVGGSADVVSGAYEHTINLQAKGQQYQEFVLQGRAPQIVLVVSNKTMPNFKSIADLKGKKIGVTAPGSSTNMMANFVLAKAGLKPSDVSFIGVGASAGAVAAMRSGQIDAMANLDPVISMLTQKNEVKIASDTRTIKETQTVFGGNMPSGCLYASVSFIQQNPNTTQAMANAMVRALKWLQKAGPSDIVKTVPESYLLGDRALYLAAWDKVKEAISPDGMMPTDGPHTALNTLQQFDPELKGKAIKLENTFTNNFVQKANAKYK GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 24->304|YTLA_BACSU|2e-12|28.3|269/334| SEG 83->95|avvggsadvvsga| SEG 175->185|gvgasagavaa| BL:PDB:NREP 1 BL:PDB:REP 120->205|3e4rA|8e-06|35.8|81/291| RP:PDB:NREP 1 RP:PDB:REP 38->342|2de3B|1e-20|13.7|293/347| RP:PFM:NREP 1 RP:PFM:REP 64->262|PF09084|6e-20|34.9|189/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 50->264|PF09084|5.2e-30|27.5|207/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 35->269|1us4A|4e-21|17.9|235/298|c.94.1.1| HM:SCP:REP 34->288|1us5A_|2.9e-45|29.3|249/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 165 OP:NHOMOORG 136 OP:PATTERN ---------------------------------1----------2----------------------- ----1----------------------------------1------------------------1111----------------------------------------------------------------------------------------------------------------------1------1111111-1-111111--11111111--1----------2------------------------------------------------------11------------------------------------1111111111111----1----11---1------1--1---111------------------112---2-11-1111111-112---1--3---3--3111111111--22-----1-----------------------------------------------------------21-11111111111111431111111131111--332--1--111411----1--1----------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 89.3 SQ:SECSTR ################################cccccccEEEEEEEcccccHHHHHHHTTHHHHTTEEEEEccGGGTTHHHHcccTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEcccEEEEEcTTEEcccccGGGGTTcEEEEHHTTHHHHHHHHHHHHHTTccGGGcEEHcTTHHHHHHHHHHHTcccEEEEEHHHHHHHHTTTcEEcccGGGHHcccccHcGGGcEEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTHHTccHHHHHHHHcTTGGGcccccccHHHHHHHHHHHHHHHHTTcccccccHHHHccHHHHHHH##### DISOP:02AL 1-6,29-33,347-348| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccEEcHHHHHHHHHHHcccHHHcccEEEEEEcccHHHHHHHHHccccHHcccccHHHHHHHHccccEEEEEEEcccccEEEEEEcccccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHEEEEEEcccHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccccHHHHccccccEEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccHHHcccHHHHHHHHHccc //