[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09004.1
DDBJ      :             L-carnitine dehydratase/bile acid-inducible protein F
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  369/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.123.1
:398 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->378 2vjoA PDBj 1e-35 30.2 %
:RPS:PDB   78->162 2c9eA PDBj 2e-31 15.3 %
:RPS:SCOP  2->397 1xa3A  c.123.1.1 * 8e-95 25.1 %
:HMM:SCOP  2->397 1q7eA_ c.123.1.1 * 1e-132 43.8 %
:RPS:PFM   70->260 PF02515 * CoA_transf_3 2e-37 45.0 %
:HMM:PFM   70->260 PF02515 * CoA_transf_3 1.2e-65 47.9 190/191  
:BLT:SWISS 6->378 FCTA_RHOPS 5e-49 34.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09004.1 GT:GENE ABF09004.1 GT:PRODUCT L-carnitine dehydratase/bile acid-inducible protein F GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2306754..2307950) GB:FROM 2306754 GB:TO 2307950 GB:DIRECTION - GB:PRODUCT L-carnitine dehydratase/bile acid-inducible protein F GB:PROTEIN_ID ABF09004.1 GB:DB_XREF GI:93354915 InterPro:IPR003673 LENGTH 398 SQ:AASEQ MARQILDGIRVLELGQLIAGPFAAKTLADFGAHVVKVEPPGQGDPLRKWRMLHEDTSVWWEAQSRNKQSIAIDLRQPEGQALVRKLASEADVLIENFRPGTMEKWGLGWDVLHADNPKLIMVRVSGYGQSGPKRDEPGFAAVAEAMSGLRYLTGEPGRPPVRAGLSLGDTIAGLHGALGVLLALYERDARGGKGQVIDVALYESLFNLSESLLPEYSAFGAVRQPAGGALPGIAPSNAYLCGCGEYVLIAANGDAIFRRLMAAMGRNDLGEDPALARNDGRVKRVDEIDAAITAWTKTQTVASALEVLRTADVPSGRIYTVKDIAEDPHYRARGVIETVTSAKGLQVEVPGIMPKLSGNPGGIHDRAPTLGEHTDSVLADAGFDAAAIADLRNRGVIA GT:EXON 1|1-398:0| BL:SWS:NREP 1 BL:SWS:REP 6->378|FCTA_RHOPS|5e-49|34.0|368/425| SEG 172->184|aglhgalgvllal| SEG 379->390|adagfdaaaiad| BL:PDB:NREP 1 BL:PDB:REP 6->378|2vjoA|1e-35|30.2|367/427| RP:PDB:NREP 1 RP:PDB:REP 78->162|2c9eA|2e-31|15.3|85/317| RP:PFM:NREP 1 RP:PFM:REP 70->260|PF02515|2e-37|45.0|189/189|CoA_transf_3| HM:PFM:NREP 1 HM:PFM:REP 70->260|PF02515|1.2e-65|47.9|190/191|CoA_transf_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02515|IPR003673| GO:PFM GO:0008152|"GO:metabolic process"|PF02515|IPR003673| RP:SCP:NREP 1 RP:SCP:REP 2->397|1xa3A|8e-95|25.1|386/400|c.123.1.1| HM:SCP:REP 2->397|1q7eA_|1e-132|43.8|393/417|c.123.1.1|1/1|CoA-transferase family III (CaiB/BaiF)| OP:NHOMO 2580 OP:NHOMOORG 544 OP:PATTERN --1----232523322-11321-51--12-32-----------------------------1-2---- --2351-2---2-16TH44-4G--DS444449FDIE5HRi-N3X1--2----442211--12B123C6635-111----1617------------------2------12--------------------------66686---32----------------------------------------22---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12--2222222-2--3-------1---1----87-1----1--------2--633A-----2-KBD--7B59A633442443442-34A33E39855-41111222133296472759222426722222222511--723------------------------------57F7-5uaHfEDDFIF5577799GE887858U7TRclb26784648A8N8I9PT456----21-------1--822-121-----2-----12--3----111111-6---------------------------1---1-4-3--1------1----1-11-1--------------1-2-3--3333333333-2333333333233223221------111111111111111111122333321--------------------1-1111-2212---------------44324242222155553656342455223------------------------------------------111111------------------------------------------------- ----111-----1126564655387673322222225666566333334756D9667124333-1---------1------111-1---3545435311-212433-2-23251221-12222223251AU3-633222231222211222225-532823212222232A1222-11-----111--73---11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 373 STR:RPRED 93.7 SQ:SECSTR #####TTTcEEEEcccTTHHHHHHHTTccHHHHHHHHHHHTTccccGGGTTccccHHHHHHcTTTTcEETTTccccTHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTcTTccccccccTTHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHcccTTcGcTTccccccccTTcccccccEEEEEcTEEEEccGGcGGGHHHHHHHTTcGGGcccTTTccHHHHTTTHHHHHHHHHHTTTTccHHHHHHHHHTTTccEEEcccHHHHHTcHHHHHTTEEEEccTTTccEEEEEcccccccccccccccccccTTccHHHHH#################### DISOP:02AL 1-3| PSIPRED cccccccccEEEEEcccHHHHHHHHHHHHHccEEEEEccccccccccccccccccccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccEEEEcccHHHHHHccccHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccEEEEEcccHHHHHHHHHHcccccccccHHcccHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEcccHHHHHHcHHHHHcccEEEEEcccccEEEEEcccccccccccccccccccccccHHHHHHHccccHHHHHHHHHccccc //