[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09006.1
DDBJ      :             DNA replication and repair protein RecR
Swiss-Prot:RECR_RALME   RecName: Full=Recombination protein recR;

Homologs  Archaea  0/68 : Bacteria  872/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
e.49.1
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->204 1vddC PDBj 3e-47 47.7 %
:RPS:PDB   10->49 1bvsB PDBj 2e-04 22.5 %
:RPS:PDB   62->204 1cy7A PDBj 2e-30 14.5 %
:RPS:SCOP  6->204 1vddA  e.49.1.1 * 9e-40 47.2 %
:HMM:SCOP  3->204 1vddA_ e.49.1.1 * 6.5e-75 56.6 %
:RPS:PFM   42->80 PF02132 * RecR 1e-06 48.7 %
:HMM:PFM   40->80 PF02132 * RecR 1.9e-17 46.3 41/41  
:HMM:PFM   84->176 PF01751 * Toprim 3.6e-12 34.5 87/96  
:HMM:PFM   11->28 PF00633 * HHH 0.00016 61.1 18/30  
:BLT:SWISS 1->204 RECR_RALME e-116 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09006.1 GT:GENE ABF09006.1 GT:PRODUCT DNA replication and repair protein RecR GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2309028..2309642) GB:FROM 2309028 GB:TO 2309642 GB:DIRECTION - GB:PRODUCT DNA replication and repair protein RecR GB:PROTEIN_ID ABF09006.1 GB:DB_XREF GI:93354917 InterPro:IPR000093 InterPro:IPR006154 InterPro:IPR006171 LENGTH 204 SQ:AASEQ MRAAPPTSLQALIEALKVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAVDGIRHCTRCNTFTELEICGTCSDPERDATLLCVVETPADQVMIEQTLTYRGQYFVLMGRLSPLDGIGPKEIHLDRLLARATDPELGGPASEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGVPVGGELEYVDAGTIARAVMDRRTL GT:EXON 1|1-204:0| SW:ID RECR_RALME SW:DE RecName: Full=Recombination protein recR; SW:GN Name=recR; OrderedLocusNames=Rmet_2127; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair;Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->204|RECR_RALME|e-116|100.0|204/204| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| BL:PDB:NREP 1 BL:PDB:REP 6->204|1vddC|3e-47|47.7|193/196| RP:PDB:NREP 2 RP:PDB:REP 10->49|1bvsB|2e-04|22.5|40/183| RP:PDB:REP 62->204|1cy7A|2e-30|14.5|138/563| RP:PFM:NREP 1 RP:PFM:REP 42->80|PF02132|1e-06|48.7|39/41|RecR| HM:PFM:NREP 3 HM:PFM:REP 40->80|PF02132|1.9e-17|46.3|41/41|RecR| HM:PFM:REP 84->176|PF01751|3.6e-12|34.5|87/96|Toprim| HM:PFM:REP 11->28|PF00633|0.00016|61.1|18/30|HHH| GO:PFM:NREP 2 GO:PFM GO:0006281|"GO:DNA repair"|PF02132|IPR015967| GO:PFM GO:0006310|"GO:DNA recombination"|PF02132|IPR015967| RP:SCP:NREP 1 RP:SCP:REP 6->204|1vddA|9e-40|47.2|193/199|e.49.1.1| HM:SCP:REP 3->204|1vddA_|6.5e-75|56.6|196/199|e.49.1.1|1/1|Recombination protein RecR| OP:NHOMO 876 OP:NHOMOORG 874 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111-11111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111---11-111111-1111-1-11111----------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 97.5 SQ:SECSTR #####cHTHHHHHHHTTccTTccHHHHHHHTTTTcccHHHHHHTGGGccHHHHHHHTTTGGEEEccHHHHHHHHTTccTTEEEEEcccccEEccccccHHHHHHHTEETTTTTEEccEEcTTTHHHHHHHHHHHHTHHHHTccEEEEcccccHHHHHHHHHHHHHHcccGGGEEEcccccccHHHHHHHccHHHHHHHHHHHHH DISOP:02AL 1-4,8-8,203-205| PSIPRED ccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccHHHHHHHHHHcccccEEEEEccEEcccccccHHHccHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHccccc //