[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09032.1
DDBJ      :             two component transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  672/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->124 3eulB PDBj 3e-13 25.8 %
:BLT:PDB   156->212 1p4wA PDBj 7e-10 50.9 %
:RPS:PDB   3->206 3c3wA PDBj 1e-22 25.1 %
:RPS:SCOP  2->134 1a04A2  c.23.1.1 * 1e-17 21.4 %
:RPS:SCOP  154->211 1yioA1  a.4.6.2 * 3e-12 27.6 %
:HMM:SCOP  1->133 1k68A_ c.23.1.1 * 3.6e-23 27.5 %
:HMM:SCOP  152->211 1p4wA_ a.4.6.2 * 1e-12 43.3 %
:RPS:PFM   5->118 PF00072 * Response_reg 2e-10 30.9 %
:RPS:PFM   155->208 PF00196 * GerE 3e-10 46.3 %
:HMM:PFM   5->118 PF00072 * Response_reg 1.1e-21 24.3 111/112  
:HMM:PFM   154->207 PF00196 * GerE 1.7e-19 42.6 54/58  
:BLT:SWISS 3->203 RCSB_SALTI 3e-26 34.7 %
:PROS 170->197|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09032.1 GT:GENE ABF09032.1 GT:PRODUCT two component transcriptional regulator, LuxR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2350869..2351510 GB:FROM 2350869 GB:TO 2351510 GB:DIRECTION + GB:PRODUCT two component transcriptional regulator, LuxR family GB:PROTEIN_ID ABF09032.1 GB:DB_XREF GI:93354943 InterPro:IPR000792 InterPro:IPR001789 LENGTH 213 SQ:AASEQ MPISIMVLDDHEIVHQGIVRVLQQNSAFAILGTFTRSRDFVQALRNKAPDLVIIDYALEPSDADGIGVIRMIRRQYPGIKILVLSAHDSPVTIALAMKAGADGYCIKNGSIADITAAIAKILRGASHIPAQVASLSVFGKEQGEGAPGSGGLTAALTEKEREVLRCFLDGMTVNEIAAKFSRSKKTVSGHKQSALRKLGIRSDNELFKVRHLI GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 3->203|RCSB_SALTI|3e-26|34.7|193/216| PROS 170->197|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 2 BL:PDB:REP 3->124|3eulB|3e-13|25.8|120/124| BL:PDB:REP 156->212|1p4wA|7e-10|50.9|55/87| RP:PDB:NREP 1 RP:PDB:REP 3->206|3c3wA|1e-22|25.1|199/211| RP:PFM:NREP 2 RP:PFM:REP 5->118|PF00072|2e-10|30.9|110/111|Response_reg| RP:PFM:REP 155->208|PF00196|3e-10|46.3|54/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 5->118|PF00072|1.1e-21|24.3|111/112|Response_reg| HM:PFM:REP 154->207|PF00196|1.7e-19|42.6|54/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 2->134|1a04A2|1e-17|21.4|131/138|c.23.1.1| RP:SCP:REP 154->211|1yioA1|3e-12|27.6|58/70|a.4.6.2| HM:SCP:REP 1->133|1k68A_|3.6e-23|27.5|131/0|c.23.1.1|1/1|CheY-like| HM:SCP:REP 152->211|1p4wA_|1e-12|43.3|60/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 3022 OP:NHOMOORG 676 OP:PATTERN ------------------------------------------1------------------------- 79E3V34511122-63322-26--49222223B5558HEF486I7A734644463-43--46A5MBGOTR61222412-12-7-----------11---5-6132I4H33-------------------1--1---99979568E58355442-1---1-211141AA8C--------1----36332--24475555557738555567799385962433422222222B9344444434444444344431---11-1--111122222--1-11112212223221111111111211111111111113121112222161721111121-1-11------4-1--9111-73112124-21111---5112111-----16E46--34455611111111111-64657A95283-511121423256-2--2212121221422222222---1263--------------------------------14--53222B55BC866553AACI999A399CDAGKH-1AA9996559877735727836511111111-1375622611162142222-21431442333333341------------------------1--651332514315545624456544457454----322------74345746775654566-7666656666756556555555666537677777777677777766655653-977777677777--434444411111274211111211111-11222222221-242CCEA9F9BA87975898---------123354555527355CB879775562222--1-222222--------1----------------------------1--------3H- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--2-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 100.0 SQ:SECSTR cHEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETEcTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHEHHHHHHHHHHHHcEEcTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHEEEccTT DISOP:02AL 137-154| PSIPRED ccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHcc //