[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09036.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->64 PF06052 * 3-HAO 0.00028 27.6 29/151  
:BLT:SWISS 35->64 3HAO_BOVIN 8e-05 46.7 %
:BLT:SWISS 35->99 3HAO_HUMAN 2e-04 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09036.1 GT:GENE ABF09036.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2357720..2358049 GB:FROM 2357720 GB:TO 2358049 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09036.1 GB:DB_XREF GI:93354947 LENGTH 109 SQ:AASEQ MNLNDVPDDFPRPTLPAVVLGGQPKVGATLSWNVYVAGLTPEERYERWFICEDIAKQLLPVAQEDAAKFPHHSPNETLRRVRVSVARKGWVSAAELDWLIQRLKTPLQW GT:EXON 1|1-109:0| BL:SWS:NREP 2 BL:SWS:REP 35->64|3HAO_BOVIN|8e-05|46.7|30/286| BL:SWS:REP 35->99|3HAO_HUMAN|2e-04|29.2|65/286| HM:PFM:NREP 1 HM:PFM:REP 36->64|PF06052|0.00028|27.6|29/151|3-HAO| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,108-110| PSIPRED ccccccccccccccccEEEEccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccc //