[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09039.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 105->170 GRPE_GEOKA 5e-04 28.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09039.1 GT:GENE ABF09039.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2359623..2360255 GB:FROM 2359623 GB:TO 2360255 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09039.1 GB:DB_XREF GI:93354950 LENGTH 210 SQ:AASEQ MAREMYHGSLSESITVFDDFTHFGTRDAAIAAAAAKAYAQPGSIRPTAYLYCVQIQVSDSQIHKVETGDWGDPTLYSTCRTLLNTQRFPELKDIELQARKIREGRSRQSKIDAEKYLIRAMADALQDRVGAFEYTNKVEDERSQSLLVVRGANVVRHGKVEKIEQSQLEAARVHNPLHHANSPANQFQEVAPHIQARDEFRNQRPSSSRT GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 105->170|GRPE_GEOKA|5e-04|28.8|66/213| SEG 28->39|aaiaaaaakaya| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,99-111,198-211| PSIPRED ccHHHccccccccEEEEccHHHccccHHHHHHHHHHHHcccccccccEEEEEEEEEEcHHHEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccEEEEEcccEEEcccHHHHHHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHcccccccc //