[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09049.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   142->178 PF05435 * Phi-29_GP3 0.00015 37.8 37/266  
:HMM:PFM   68->149 PF08614 * ATG16 0.0004 19.4 72/194  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09049.1 GT:GENE ABF09049.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2372325..2372993) GB:FROM 2372325 GB:TO 2372993 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09049.1 GB:DB_XREF GI:93354960 LENGTH 222 SQ:AASEQ MKKPSSFAAWQEANQVRREAIIEDYLQYLGKTRVRVRNPTDLADLVARHIAQVEDGPCNKSTLMRNFRYKAKILTYQAEHSESGSRSLRPRGVTDPSTNALVTIAKLEAGNLKREVGRLNIYINSLEEQLEQYQQQGRQRLSELVAHKAESGAHRISDYEFKFVRTCQALRALVSHMNLVLEVDTKAQRILDRSKRRNNVIVDNEIAGPFIEWLASVSEEVK GT:EXON 1|1-222:0| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 104->135| SEG 126->141|leeqleqyqqqgrqrl| HM:PFM:NREP 2 HM:PFM:REP 142->178|PF05435|0.00015|37.8|37/266|Phi-29_GP3| HM:PFM:REP 68->149|PF08614|0.0004|19.4|72/194|ATG16| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8,77-92,130-143,221-223| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHcccccccHHHHHHHccEEEEEEEEEEccccccccccccccccccccccEEEEEEEccccHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHcc //