[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09063.1
DDBJ      :             Phosphate ABC transporter, permease protein PstC
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  783/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:321 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   80->237 3dhwA PDBj 2e-06 26.7 %
:RPS:PDB   196->235 3dhwA PDBj 3e-09 25.6 %
:RPS:SCOP  80->303 2r6gG1  f.58.1.1 * 2e-12 14.1 %
:RPS:PFM   89->256 PF00528 * BPD_transp_1 2e-07 32.4 %
:HMM:PFM   97->310 PF00528 * BPD_transp_1 1.1e-19 24.1 174/185  
:BLT:SWISS 8->321 PSTC_SHIFL e-111 66.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09063.1 GT:GENE ABF09063.1 GT:PRODUCT Phosphate ABC transporter, permease protein PstC GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2391375..2392340) GB:FROM 2391375 GB:TO 2392340 GB:DIRECTION - GB:PRODUCT Phosphate ABC transporter, permease protein PstC GB:PROTEIN_ID ABF09063.1 GB:DB_XREF GI:93354974 InterPro:IPR000515 InterPro:IPR011864 LENGTH 321 SQ:AASEQ MATSSDLPVVRPPSRLGDILFGGLTRGAAIVTLLLLGGIIVSLAISAWPSISKFGISFLWNSEWDPPADVYGALVPVYGTIVTSLIALIIAVPVSFGIALFLTELSPAWLRRPLGTAIELLAAVPSIVYGMWGLLVFSPIFGEYFQKPLANTIGQVPVIGKLFQGAPLGIGLLCAGVILAIMIIPYIASVMRDVFEVTPVLLKESAYGIGCTTWEVMWRVVLPYTRAGVIGGVMLGLGRALGETMAVTFVIGNTNILDNVSLFSPGNSITSALANEFAEAGAGLHTAALMELGLILFFITFVVLALSKLLLLRLAKNEGGK GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 8->321|PSTC_SHIFL|e-111|66.9|314/319| TM:NTM 6 TM:REGION 21->43| TM:REGION 77->99| TM:REGION 118->140| TM:REGION 165->187| TM:REGION 210->232| TM:REGION 289->311| SEG 27->46|gaaivtllllggiivslais| SEG 304->316|lalskllllrlak| BL:PDB:NREP 1 BL:PDB:REP 80->237|3dhwA|2e-06|26.7|131/203| RP:PDB:NREP 1 RP:PDB:REP 196->235|3dhwA|3e-09|25.6|39/203| RP:PFM:NREP 1 RP:PFM:REP 89->256|PF00528|2e-07|32.4|148/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 97->310|PF00528|1.1e-19|24.1|174/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 80->303|2r6gG1|2e-12|14.1|191/284|f.58.1.1| OP:NHOMO 1449 OP:NHOMOORG 844 OP:PATTERN 221112--1111111-1-21122132232232222111111112111121411111-11-1---2-11 12--522222321222322-2111322222221111121211121222222222222222112112123222222222-121121122222211--------2--21-1----------------22132423212222341112134333362222122212223352621111111111111112222-1223333344333334331222223341322122111111242111111111111112222211211111111111111111111222333333322244444445444222222222222222222222232231212122222122222-222323223122222431-412222221-1112211322222121112211111111111111111-11211111112221131123413314-22212121111122222222222211112212222122---------------2221222121111111111111111111111111111111111-111122122121111213112224-------111211125221211123321221121442221211341--11111111---------2121133222211221242222222422222443222--11111------11221121111111111-1111111111111111111111221111111111111111111211111112-122222212222--11---------12232111----1111---111111121111211111123233312222---------12224444444434411112112221111--21--111122222222--2----1---1--11----111--111-111-2-222112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 47.4 SQ:SECSTR ###############################################################################HHHHHHHHHHTTGGG##GGGGGGGTcccccHHHHHHHHHHHHHHccHHHHHHH#HHHHHHH#################TTcc#######cccHHHHHHHHHHHHHHHHHHHHHHHHHcccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHccHHHHHHH############################################################### DISOP:02AL 1-14,317-322| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //