Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09089.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09089.1 GT:GENE ABF09089.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2422413..2422700) GB:FROM 2422413 GB:TO 2422700 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09089.1 GB:DB_XREF GI:93355000 LENGTH 95 SQ:AASEQ MLRSRPDDNTLECAAHLYFNIAWRLREMICVKVVKALLRELGQGRVTVNGAFGAVNPPGRCDICRLGARPRASSGMSKPQRRKVWACRSGKNHQP GT:EXON 1|1-95:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,69-83,86-88,90-96| PSIPRED ccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEccccccccccccccHHcEEEEEcccccccc //