[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09094.1
DDBJ      :             Rhodanese-like protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  66/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.46.1
:532 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->532 1yt8A PDBj e-170 68.0 %
:RPS:PDB   24->235 2eg3B PDBj 6e-27 19.0 %
:RPS:PDB   289->479 2eg3B PDBj 6e-15 16.2 %
:RPS:SCOP  15->109 1yt8A2  c.46.1.2 * 2e-21 66.7 %
:RPS:SCOP  110->244 1yt8A1  c.46.1.2 * 2e-24 77.8 %
:RPS:SCOP  275->372 1yt8A4  c.46.1.2 * 2e-15 67.3 %
:RPS:SCOP  387->532 1yt8A3  c.46.1.2 * 3e-19 63.7 %
:HMM:SCOP  5->126 1yt8A3 c.46.1.2 * 5.5e-29 37.3 %
:HMM:SCOP  110->245 1yt8A1 c.46.1.2 * 2.1e-30 30.9 %
:HMM:SCOP  246->356 1yt8A1 c.46.1.2 * 3.7e-17 31.5 %
:HMM:SCOP  376->532 1yt8A3 c.46.1.2 * 2.3e-40 33.8 %
:RPS:PFM   19->106 PF00581 * Rhodanese 2e-09 46.0 %
:RPS:PFM   283->356 PF00581 * Rhodanese 4e-07 34.4 %
:RPS:PFM   391->471 PF00581 * Rhodanese 1e-05 31.6 %
:HMM:PFM   18->106 PF00581 * Rhodanese 1.5e-16 39.5 86/113  
:HMM:PFM   139->230 PF00581 * Rhodanese 4.9e-10 28.9 90/113  
:HMM:PFM   286->356 PF00581 * Rhodanese 5.6e-07 32.4 71/113  
:HMM:PFM   385->473 PF00581 * Rhodanese 2.5e-11 31.8 88/113  
:BLT:SWISS 1->203 THTR_AZOVI 1e-06 27.6 %
:BLT:SWISS 398->478 YGAP_ECOLI 6e-05 33.3 %
:REPEAT 3|18->108|142->232|389->475
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09094.1 GT:GENE ABF09094.1 GT:PRODUCT Rhodanese-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2428177..2429775) GB:FROM 2428177 GB:TO 2429775 GB:DIRECTION - GB:PRODUCT Rhodanese-like protein GB:PROTEIN_ID ABF09094.1 GB:DB_XREF GI:93355005 InterPro:IPR001763 LENGTH 532 SQ:AASEQ MTEVQSFPTTTSLAVRQALLDRTEIALIDVREEDPYAQQHPLWAANFPLSKLELEAWARIPRRDTRIVVYGEHDGEDLAPGAAARLRELGYTDVSLLDGGLTAWIAAGGEVFRDVNVPSKSFGELVEAKRHTPSLGAPEVQALIDGKADVVIVDARRFDEYQTMSIPTATSLPGAELVLRIRELAPNPATQVIVNCAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWKLAGQELDHGASRVAPVQVDAANHGKAREGAGAIAARAGVRRIGLGELASLHVPDRTVYQFDVRTPEEYAASHLPGFRSAPGGQLVQETDHQAPVRGARIVLADDDGVRANMSASWLAQMGWEVYVVDPVGEDKRSERGLAAANVPPSPEVVTVSPVALAAWLKEGDVAVIDVTASANYVKRHIPGAWFAIRAQLAQAIKAIRPAKRYVLTCGSSLLARFAAVDLRALTSAEVFVLEGGTAAWVEAGLPVEQGETRLAVPRTDRYRRPYEGTDNAAAAMQAYLDWEFGLIAQLDRDRTHFFEVV GT:EXON 1|1-532:0| BL:SWS:NREP 2 BL:SWS:REP 1->203|THTR_AZOVI|1e-06|27.6|199/271| BL:SWS:REP 398->478|YGAP_ECOLI|6e-05|33.3|81/174| NREPEAT 1 REPEAT 3|18->108|142->232|389->475| SEG 253->274|gkaregagaiaaragvrriglg| SEG 373->385|vppspevvtvspv| BL:PDB:NREP 1 BL:PDB:REP 35->532|1yt8A|e-170|68.0|488/521| RP:PDB:NREP 2 RP:PDB:REP 24->235|2eg3B|6e-27|19.0|195/226| RP:PDB:REP 289->479|2eg3B|6e-15|16.2|181/226| RP:PFM:NREP 3 RP:PFM:REP 19->106|PF00581|2e-09|46.0|87/108|Rhodanese| RP:PFM:REP 283->356|PF00581|4e-07|34.4|74/108|Rhodanese| RP:PFM:REP 391->471|PF00581|1e-05|31.6|81/108|Rhodanese| HM:PFM:NREP 4 HM:PFM:REP 18->106|PF00581|1.5e-16|39.5|86/113|Rhodanese| HM:PFM:REP 139->230|PF00581|4.9e-10|28.9|90/113|Rhodanese| HM:PFM:REP 286->356|PF00581|5.6e-07|32.4|71/113|Rhodanese| HM:PFM:REP 385->473|PF00581|2.5e-11|31.8|88/113|Rhodanese| RP:SCP:NREP 4 RP:SCP:REP 15->109|1yt8A2|2e-21|66.7|93/101|c.46.1.2| RP:SCP:REP 110->244|1yt8A1|2e-24|77.8|135/136|c.46.1.2| RP:SCP:REP 275->372|1yt8A4|2e-15|67.3|98/130|c.46.1.2| RP:SCP:REP 387->532|1yt8A3|3e-19|63.7|146/157|c.46.1.2| HM:SCP:REP 5->126|1yt8A3|5.5e-29|37.3|118/0|c.46.1.2|1/4|Rhodanese/Cell cycle control phosphatase| HM:SCP:REP 110->245|1yt8A1|2.1e-30|30.9|136/0|c.46.1.2|2/4|Rhodanese/Cell cycle control phosphatase| HM:SCP:REP 246->356|1yt8A1|3.7e-17|31.5|111/0|c.46.1.2|3/4|Rhodanese/Cell cycle control phosphatase| HM:SCP:REP 376->532|1yt8A3|2.3e-40|33.8|157/0|c.46.1.2|4/4|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 92 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------1 -------------------------1--------------------------------------------------------1-------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------2-112--------------------------------111----------------------------------------------------------------------------44111111111----1111------1143112-122------2-1-32------------------------------------------1----------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------1-------------------------2-11-1-1-2--2---211111111111---------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 527 STR:RPRED 99.1 SQ:SECSTR cGGGTTcccEEcHHHHHTccccTTcEEEEcccHHHHHHcccTTcEEcccccccccHHHHHTTccccEEEEcccccHcHHHHHHHHHHHHTTccEEEEccccGGGcccccccccccccccccccccccccTTcccccGGGcccHHHHHTcccEEEcccHHHHTTccccTcEEccGGGGGccTTHHHHHcTTcEEEEEcccccHHHHHHHHHHTTcccEEEEcccHHHHHHHTTcccGEEccc####ccccccHHHHHHHHHHHHHHHHHHTcEEEHHHHTTTEcTTcEEEEcccHHHHHHcccTTcEEccccccccccccHHHHHcccEEEEEccHHHHHHHHHHHHHTTccEEEEEcccccccccccEEcccccccHHHHHHHHHHHHHHHHHTTccEEccTTccccTTccHHHHHHHHHHHTTcccEEEEcTTcEEEEEcccccHHHHHHHHHHTTTcEEEEcccHHHHHHHTTccccEEcTcccTTcGGGcccTTccccccHHH#HHHHHHHHTHHHHHHHHcccccccc DISOP:02AL 1-5,251-251,526-526| PSIPRED cccccccccccHHHHHHHHHccccEEEEEcccHHHHHcccccccEEccHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccHHHHHHccccccEEccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHccccccEEEEcccHHHHHHccccEEEcccccccccccccccccHHccccHHHHHHccHHHcHHHHHHHHcccccEEEEEcccHHHHHHccccccccccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHccccEEEEEcccHHHHHHcccccccccccccEEEEcHHHHHHHHHcccEEEEEcccHHHHHHccccccEEccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccccEEEEcccHHHHHHcccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEcc //