[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09098.1
DDBJ      :             ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  90/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:341 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   108->179 2waqB PDBj 6e-04 33.3 %
:RPS:PDB   59->329 2czlA PDBj 3e-23 14.2 %
:RPS:SCOP  9->329 1dioA  c.1.19.3 * 3e-22 11.1 %
:HMM:SCOP  42->276 1xs5A_ c.94.1.1 * 3.9e-36 24.8 %
:RPS:PFM   71->267 PF09084 * NMT1 2e-11 32.1 %
:HMM:PFM   58->271 PF09084 * NMT1 2.9e-25 25.6 211/216  
:BLT:SWISS 59->266 NRTC_SYNY3 5e-11 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09098.1 GT:GENE ABF09098.1 GT:PRODUCT ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2433026..2434051 GB:FROM 2433026 GB:TO 2434051 GB:DIRECTION + GB:PRODUCT ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components GB:PROTEIN_ID ABF09098.1 GB:DB_XREF GI:93355009 InterPro:IPR002197 LENGTH 341 SQ:AASEQ MSQQPSQKSSRPDNRRRSLLRLAGTTAIAAPALILGRQAWSAPRKLTFAWNQNSFCLTPIVVAQEKGFFEKNGLQVDLINYSGSTDQLLESIATGKADAAVGMIHRWLKPLEAGFDVKIIGSSHGGCVRLVGAKAAGVTNLQALKGKTVGVSDLAAPGKHFFTILLAKNGIDPDRDITWRQYPADLLGVAVDKGEIQAIADGDPNLYLLEKRTNGAYVELATNLTGEYARKVCCVVGARGELVRNDRPTAAALARSIVQATDYVNENPNEAAKVFAKYSPKISPDDLRKLYATLTYTHHPTGVDLQEEIAFYADDFRRIGVLKKSTDAKRLAQHVYANVLG GT:EXON 1|1-341:0| BL:SWS:NREP 1 BL:SWS:REP 59->266|NRTC_SYNY3|5e-11|30.5|203/670| BL:PDB:NREP 1 BL:PDB:REP 108->179|2waqB|6e-04|33.3|72/1090| RP:PDB:NREP 1 RP:PDB:REP 59->329|2czlA|3e-23|14.2|254/269| RP:PFM:NREP 1 RP:PFM:REP 71->267|PF09084|2e-11|32.1|184/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 58->271|PF09084|2.9e-25|25.6|211/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 9->329|1dioA|3e-22|11.1|307/551|c.1.19.3| HM:SCP:REP 42->276|1xs5A_|3.9e-36|24.8|226/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 116 OP:NHOMOORG 100 OP:PATTERN --------------------------------1----------1---1--1--1-------------- ----------------------------------------------------------------1---------------------------------------------------------------------------------1-1--------1------1--1------------------1----------------------------------------------------------------------------------------------------11--------------------------------------2------------11------21------22-------1--------------------1213---2--2-1111111-11--11111111----------2-----22-----1-------11111111-22-1-------------------------------------------111111-----11--------1121111--11-1----11--1----------------------------1----------2--1-----------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------11----1--1--------------1--------1--1----------------------------------------------1-------------------------------------------------------- ------------------1-------------------------------------------------------1-----1---1-----------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 97.4 SQ:SECSTR ########HHTTcccEEEEEEccccHHHHHHTHHHHHHHHcccccEEEEEcTTcHHHHHHHHHHHTTccccTcccEEEEEccHHHHHHHHHHHTTcccEEEEEHHHHTTcTTTEEEcccccEEEcccEEEcccEEEEcccccccTTcEEEEccTTcHHHHHHHHHccccEEEEccGGGHHHHHHHHccEHHHTTcccEEEEcTTHHHHGGGGTcEEEEEHHHHHHHHHcccEEEEEEEEHHEGGGcHHHHHHHHHHHHHHHHHHHHcGGGGHHHHHHHcTTccHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHTTcccccccccccHcHHHHHHH# DISOP:02AL 1-13| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHHccHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEEcccccEEEEEccccccccHHHHcccEEEEcccccHHHHHHHHHHHHccccHHHcEEEEEccHHHHHHHHHcccccEEEEcccHHHHHHHcccccEEEEEccccccccccccEEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHc //