[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09104.1
DDBJ      :             isochorismatase hydrolase
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  205/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->200 3irvA PDBj 6e-12 29.7 %
:RPS:PDB   25->196 2a67A PDBj 4e-31 24.8 %
:RPS:SCOP  24->200 1nf8A  c.33.1.3 * 7e-30 25.0 %
:HMM:SCOP  1->200 1nbaA_ c.33.1.3 * 1.6e-43 35.6 %
:RPS:PFM   26->197 PF00857 * Isochorismatase 3e-14 40.0 %
:HMM:PFM   27->195 PF00857 * Isochorismatase 4.4e-38 36.9 157/174  
:BLT:SWISS 28->195 YRDC_BACSU 3e-16 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09104.1 GT:GENE ABF09104.1 GT:PRODUCT isochorismatase hydrolase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2439108..2439716) GB:FROM 2439108 GB:TO 2439716 GB:DIRECTION - GB:PRODUCT isochorismatase hydrolase GB:PROTEIN_ID ABF09104.1 GB:DB_XREF GI:93355015 InterPro:IPR000868 LENGTH 202 SQ:AASEQ MSVAPVPTTLLDAAGASRQPSAWSDAVLVLVDHQREYVDGKLPLTGMPEAVASCGELLALARRYGSPVIHVVHHGKAGGAFDPAGPHAAIIEGLTPVDGEQSVVKHLPNSFAGTDLADLLVATGKKELIVAGFQTHMCISATVRSALDHGYRVTLVAAACATRDLPDPLGGAPLSAAVLHRVTLAALNDRFATVVADASVWH GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 28->195|YRDC_BACSU|3e-16|30.5|167/187| BL:PDB:NREP 1 BL:PDB:REP 28->200|3irvA|6e-12|29.7|172/213| RP:PDB:NREP 1 RP:PDB:REP 25->196|2a67A|4e-31|24.8|161/163| RP:PFM:NREP 1 RP:PFM:REP 26->197|PF00857|3e-14|40.0|160/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 27->195|PF00857|4.4e-38|36.9|157/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 24->200|1nf8A|7e-30|25.0|164/207|c.33.1.3| HM:SCP:REP 1->200|1nbaA_|1.6e-43|35.6|188/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 443 OP:NHOMOORG 272 OP:PATTERN ---1------------1-------11111-11-----------1---2----1---------21---- -21-1----------------1---2------2111-----1-11-------1----1--------1-14-------------------------------1----------------------------------1--11---1------------------------------------------------1333333231343344----12333------11111---1---------------1---------------------1--------------------------------------------------------2-------1---1-------------1-------------------1-1---------11322------1-----------2-32422121-1-----123222112--1---1-------111111111-------2-------------------------------1--12---1255562-111133221111132113332--111-12--31-13---1-11-31-----------11-----11--11221-121-111-2-----1-11-----------------------1--------1-----1111---1---1-----1-------------------1-------------------------------1----------------------3---------1--------------------------111---------------11111-11122-33332555233321543-------------------1----22---------------------------------------------------------------------1- ----12--------111121111111-1111-1---111111111121--111211--------1-------11------------------1----11----1-1----------------------------------------------------1------1----2--------7-----1---1--1-1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 97.0 SQ:SECSTR ####ccccGGGcccccccccccTTcEEEEEEcccTTccccccccTTHHHHHHHHHHHHHHHHHTTccEEEEEEccTTTcTccTTcTTTcccTTccccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEcccccccccccccccHHHHHHHHHHHHcTTTcEEcccHHH## DISOP:02AL 1-3,12-20| PSIPRED ccccccccccccHHHcccccccHHHcEEEEEcccHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHccccccEEEEcccccccccHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccccccEEccHHHHHHHHHHHHHccccEEEcHHHHcc //