[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09112.1
DDBJ      :             ABC transporter-related protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  905/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.40.6c.37.1
:366 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   23->291 1g291 PDBj 3e-52 43.8 %
:RPS:PDB   1->242 3dmdC PDBj 4e-40 9.9 %
:RPS:SCOP  23->242 1b0uA  c.37.1.12 * 7e-37 25.2 %
:RPS:SCOP  246->351 3d31A1  b.40.6.3 * 4e-09 19.2 %
:HMM:SCOP  6->240 1g2912 c.37.1.12 * 9.8e-54 36.4 %
:HMM:SCOP  242->359 1q12A1 b.40.6.3 * 5.6e-14 32.7 %
:RPS:PFM   48->166 PF00005 * ABC_tran 2e-12 32.5 %
:HMM:PFM   48->167 PF00005 * ABC_tran 7.3e-15 33.0 112/118  
:HMM:PFM   284->352 PF08402 * TOBE_2 1.8e-08 29.4 68/75  
:HMM:PFM   25->68 PF03193 * DUF258 5e-06 30.2 43/161  
:BLT:SWISS 29->328 UGPC_RHOS4 1e-56 42.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09112.1 GT:GENE ABF09112.1 GT:PRODUCT ABC transporter-related protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2448183..2449283) GB:FROM 2448183 GB:TO 2449283 GB:DIRECTION - GB:PRODUCT ABC transporter-related protein GB:PROTEIN_ID ABF09112.1 GB:DB_XREF GI:93355023 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 LENGTH 366 SQ:AASEQ MARIDLDLAHAYVANPQKDEDYALLPLHFTFEDGGAYALLGPSGCGKTTLLNCISGLLRPSQGTISFDGKDVTGDSPQARNIAQVFQFPVIYDTMTVGENLAFPLRNRGVPAAQVKERVGRVAEMLDLSASLDRRASGLAADAKQKISLGRGLVRQDVSAILFDEPLTVIDPHLKWQLRRKLKEIHHEFRLTLIYVTHDQTEALTFADQVVVMSRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPGQWRDGGIEMAGRRYAPDLSPDVAARLQAAGSFKVGVRPEYLKLAAGNDPQALPVRVERAQDIGTYWLVSSTVDHGEAATLRARLGTEAAHLRAGDTAWLSVFNRHTCFYVNEELVQ GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 29->328|UGPC_RHOS4|1e-56|42.8|285/349| BL:PDB:NREP 1 BL:PDB:REP 23->291|1g291|3e-52|43.8|267/372| RP:PDB:NREP 1 RP:PDB:REP 1->242|3dmdC|4e-40|9.9|223/318| RP:PFM:NREP 1 RP:PFM:REP 48->166|PF00005|2e-12|32.5|117/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 48->167|PF00005|7.3e-15|33.0|112/118|ABC_tran| HM:PFM:REP 284->352|PF08402|1.8e-08|29.4|68/75|TOBE_2| HM:PFM:REP 25->68|PF03193|5e-06|30.2|43/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 23->242|1b0uA|7e-37|25.2|218/258|c.37.1.12| RP:SCP:REP 246->351|3d31A1|4e-09|19.2|104/119|b.40.6.3| HM:SCP:REP 6->240|1g2912|9.8e-54|36.4|231/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 242->359|1q12A1|5.6e-14|32.7|113/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 41537 OP:NHOMOORG 1168 OP:PATTERN TTI8OMGFTQSPTOWMjHRQNOOXvORehTfUF8BBCAGFFEBPYOUaIO*tb7OYPSXMOJKDV17A MUiG*WRZddhTUJUSTON-Nb99R*OOOOOKmihjm***S*S*i*lYjYSKtqnJOO9Aqqsd*mt***aVOOOqYVUMzcjA9B9CKJKF3FCEE--BEKFFFaFSNJ5656656ACB7777DPLFMOLHOPUNinot*GGHwZfgfqbafafRTIDIDIFbcXfvwnQEKDGEEDHCEDBdSXPPid7Pbp********z********ssuv***Zkp*zbhloolmm**QXYaYbWVXXXXXXWUTQTVtZWXzxXNZUfsrMNz*bQNXgeYaamkoilgrnnmikkjhhloilkYWYXWYYZaZYXXuhgXXXjhkec*u*********e*di*yyWadW*efnf*UkRI**jiWYbmPWbUibJRTOLZSPPIFJFEFZV***SLp************z***-lq*ic*h***OA**************HGH**********LKLLLLLLpUZGObU*66545444543334784345423347576JBC9CB***********tyxzt********g********8Jsrjwiujo*x****VheJRHPeSGHGFHFFNKIVdeXy*PbRtdRipZYnGbZXPRVgSTUTQVmvW*BEFGAGFEHDB566666666BJADGIHkgoMlOWHNFqKSUWSMSXPOOQQSTRTXS5-AGRII111---*x**T*oruuvsxvxrq-trqsvrwtsruxtopqpop*****YcXkiihjjkjjihgjghh*lgioonoO1************23FFCEBCDIIIHKE*l*RRQRUSHILHGNJMWKLNKLEPCMNjdpmoon***o**rqf***CDC9BCCBDGahhnijjjjv*qvtJKJGIGGFHGDCCC43IRJJGFGH68677877zBSBAB99-77B8CEAAAB78AACB889QafRTd*ebbDYN --11TNA-QG38IREA6A97DF9E5GCAA7868FAB5867766456979DDBICACD376663692342552855452467A869E33-67664436554537FB71BQaUKKLcORECD7CLHdd8i8**a4XMdHGC8W7DhMAJDBBUA8*FPKJgES*CbEL7aMO*OUJC8DB7*6A68FVMQ*7gR87iWlfM ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 366-367| PSIPRED ccEEEEEEEEEEccccccccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEEEccEEEEEccccccccccccccccccccEEEEEEcccEEEEEccccccEEEEEEEEEEEcccEEEEEEEEccccEEEEEEEccccccccccccEEEEEEcHHHEEEEcHHHccc //