[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09121.1
DDBJ      :             putative signal peptide protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09121.1 GT:GENE ABF09121.1 GT:PRODUCT putative signal peptide protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(2457374..2457805) GB:FROM 2457374 GB:TO 2457805 GB:DIRECTION - GB:PRODUCT putative signal peptide protein GB:PROTEIN_ID ABF09121.1 GB:DB_XREF GI:93355032 LENGTH 143 SQ:AASEQ MKRQLIVRAFAGAVLLGSAAALAPAAMAQVSINIGIGVPPPAPVYEVVPPPRAGYVWAPGYWDWDDHGHKHAWKKGHWVGERPGYVYEQPRWVRASNGWVLQPERWNRGPGRGDDDDQGHGHDHDRGRGGYHCPPGHAKKGEC GT:EXON 1|1-143:0| TM:NTM 1 TM:REGION 11->33| SEG 9->28|afagavllgsaaalapaama| SEG 38->51|vpppapvyevvppp| SEG 62->80|wdwddhghkhawkkghwvg| SEG 108->132|rgpgrgddddqghghdhdrgrggyh| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,113-122,137-137,139-144| PSIPRED cccEEEEEEccccHHHcccHHcccccEEEEEEEEEEccccccccEEEcccccccEEEcccccccccccHHHHHHcccccccccccEEEccEEEEcccccEEcccccccccccccccccccccccccccccccccccccccccc //