[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09134.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:251 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->248 1ionA_ c.37.1.10 * 6e-33 26.2 %
:HMM:PFM   1->238 PF06564 * YhjQ 2.5e-19 25.8 229/244  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09134.1 GT:GENE ABF09134.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2474337..2475092 GB:FROM 2474337 GB:TO 2475092 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09134.1 GB:DB_XREF GI:93355045 LENGTH 251 SQ:AASEQ MNTVAIVSTTGGAGRSTLTAELASLLAQRKHPALALECDPANVLGFHFGMREIPEDGLGAYLDAPTPGAWARAGQRSDDDVLFVPWGSGGAPAALANAAPDWLGRLLAQVDLPPRGVTLIDCARWPSPLADQAIAAADLVLVLAPAQPETCLTLRRLADALTAQGKTARYVATRLQPARQLHVDIVALLQAMLGQDMLPYHVHDDSSVAEALARSESFCRSTPHSQAAHDMNGLASWLSAWLEAATQESRP GT:EXON 1|1-251:0| SEG 16->27|stltaelaslla| SEG 91->100|apaalanaap| SEG 128->147|pladqaiaaadlvlvlapaq| SEG 152->163|ltlrrladalta| SEG 234->245|laswlsawleaa| HM:PFM:NREP 1 HM:PFM:REP 1->238|PF06564|2.5e-19|25.8|229/244|YhjQ| HM:SCP:REP 1->248|1ionA_|6e-33|26.2|240/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111-----11-------1-1--1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 247-252| PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccccccHHcccccccccccHHHHHcccccHHHHHHHHcccccEEEEEccccccHHHHHcccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //