[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09137.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->52 PF10945 * DUF2629 3.1e-05 33.3 36/44  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09137.1 GT:GENE ABF09137.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2479249..2479476 GB:FROM 2479249 GB:TO 2479476 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09137.1 GB:DB_XREF GI:93355048 LENGTH 75 SQ:AASEQ MSKPIGSRKAATAYSDIDMLAQHVDGFDAQQYFDQQVEVETVAAAQRWPLLARVMGCAALAEAEPAVAVGPSGGG GT:EXON 1|1-75:0| SEG 58->69|aalaeaepavav| HM:PFM:NREP 1 HM:PFM:REP 16->52|PF10945|3.1e-05|33.3|36/44|DUF2629| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,73-76| PSIPRED ccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEccccccc //