[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09152.1
DDBJ      :             fumarase
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  475/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.8.9d.131.1
:521 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->112 2pbyA PDBj 8e-04 35.6 %
:BLT:PDB   337->503 1vpjA PDBj 1e-13 30.6 %
:RPS:SCOP  59->164 1ge8A2  d.131.1.2 * 1e-20 11.3 %
:RPS:SCOP  332->503 2isbA1  c.8.9.1 * 3e-57 33.9 %
:HMM:SCOP  328->503 2isbA1 c.8.9.1 * 7.8e-60 48.6 %
:RPS:PFM   23->297 PF05681 * Fumerase 9e-60 47.9 %
:RPS:PFM   332->506 PF05683 * Fumerase_C 2e-49 51.4 %
:HMM:PFM   23->301 PF05681 * Fumerase 6.7e-108 54.5 268/271  
:HMM:PFM   303->507 PF05683 * Fumerase_C 3.8e-91 59.3 204/206  
:BLT:SWISS 64->498 FUMA_SALTY 4e-46 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09152.1 GT:GENE ABF09152.1 GT:PRODUCT fumarase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2495497..2497062 GB:FROM 2495497 GB:TO 2497062 GB:DIRECTION + GB:PRODUCT fumarase GB:PROTEIN_ID ABF09152.1 GB:DB_XREF GI:93355063 InterPro:IPR004646 InterPro:IPR004647 LENGTH 521 SQ:AASEQ MIPGCVSPLPIPHKMTVIKQEDLIQSVADSLQYISYYHPMDYITSLGRAYELEKSPAAKDAIAQILTNSRMCAEGKRPLCQDTGIVTVFLKVGMNVRWDGATMSLEDMVNEGVRRAYNDVDNKLRASVLADPAGKRTNTKDNTPAVINMSIVPGDTVDVIVAAKGGGSEAKSKFVMLNPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMLLAKEALMEPIDIQDLLARGPSNRAEELRIELYEKVNALGIGAQGLGGLATVLDVKVLDYPTHAANLPVAMIPNCAATRHAHFTLDGSGVAKLEAPDLSQWPKVEWAPNTETSKSVDLNTLTPEEVASWKPGQTLLLNGKMLTGRDAAHKRIADMLAKGEKLPIDFTNRVIYYVGPVDPVRDEVVGPAGPTTATRMDKFTETMLSQTGLIAMIGKAERGPTAIESIQKHKSAYLMAVGGAAYLVSKAIRGAKVLAFEDLGMEAIYEFDVKDMPVTVAVDSSGTSVHKTGPAEWQAKIGKIPVATA GT:EXON 1|1-521:0| BL:SWS:NREP 1 BL:SWS:REP 64->498|FUMA_SALTY|4e-46|32.3|427/580| SEG 212->225|aekamllakealme| SEG 254->266|algigaqglggla| BL:PDB:NREP 2 BL:PDB:REP 17->112|2pbyA|8e-04|35.6|90/291| BL:PDB:REP 337->503|1vpjA|1e-13|30.6|160/170| RP:PFM:NREP 2 RP:PFM:REP 23->297|PF05681|9e-60|47.9|265/271|Fumerase| RP:PFM:REP 332->506|PF05683|2e-49|51.4|175/184|Fumerase_C| HM:PFM:NREP 2 HM:PFM:REP 23->301|PF05681|6.7e-108|54.5|268/271|Fumerase| HM:PFM:REP 303->507|PF05683|3.8e-91|59.3|204/206|Fumerase_C| GO:PFM:NREP 2 GO:PFM GO:0016829|"GO:lyase activity"|PF05681|IPR004646| GO:PFM GO:0016836|"GO:hydro-lyase activity"|PF05683|IPR004647| RP:SCP:NREP 2 RP:SCP:REP 59->164|1ge8A2|1e-20|11.3|106/122|d.131.1.2| RP:SCP:REP 332->503|2isbA1|3e-57|33.9|171/178|c.8.9.1| HM:SCP:REP 328->503|2isbA1|7.8e-60|48.6|175/0|c.8.9.1|1/1|FumA C-terminal domain-like| OP:NHOMO 923 OP:NHOMOORG 540 OP:PATTERN ---1-22----------2111212--------322212222222222222222222222-----2--- -11-12-------------------1----------1121--------------------111-111111----------2422-22211111111-----1----1------------------11111-111-------222--------------------------------------------22211-111111111111111-1----1111111---------1--------------------------------22---------------------------------------------------------22-22222222222222222---222--4242422222222422222---12----------11111--11111111111111111------11211--1--1111112---1---1-1------111111111111-13-1------------------------------11111133-41111111111111131111-111113131111111111111122211-11111-211111---1111111122424222221111111-122121121142-2-------2--------4222--113111111111111111111121111211----1--------51111214554444444-544454445454544444554411---635464665664644614224444--211111111111---1----------1111---------------1111111---3111111111111121111111111111-1111111111111111111111111111111211------------2---------------------------222--22222-11 11----1-422--2---------------------------------------------------------------------------------------------1112-----------------------------------------------2---111---------1-1118111---------112---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 48.0 SQ:SECSTR ################cccHHHHHHHHHHHHTTGGGcccccccGGGGGccTTccEEEEEcTTccEEcTTHHHHHHHHHHHHHHHHHHHHHHcccccc######cccTTcHHH################################################################################################################################################################################################################################ccHHHHHHccTTcEEEEEEEEEEccHHHHHHHHHH#HHTcccccccTTcEEEccccEEEEcccEEEEcccccGGG#TTTHHHHHHHcc#cEEEEcc####ccHHHHHHTTTEEEEEcccccTTGGGGEEEEEEEEcGGGcTTcEEEEEEEEEEEEEEEcTTcccTTc################## DISOP:02AL 1-5,7-7,520-522| PSIPRED ccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEcccEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccccHHcccccccccccccccccEEEEEEccccEEEEEEEEcccccccccHHHccccHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHHcHHcccHHccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHEEEEEEcccccccccEEEEccccHHccEEEEEccccHHHcccccHHHHHHHHcccccccEEEEEcccccHHHHHHcccccEEEEccEEEEEHHHHHHHHHHHHHccccccccccccEEEEEccccccccEEEEEEcccccccccccHHHHHHHcccEEEEEcccccHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHcccccccc //