[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09156.1
DDBJ      :             TonB-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.212.1
:219 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  146->219 1ihrA  d.212.1.2 * 6e-15 18.8 %
:HMM:SCOP  104->219 1lr0A_ d.212.1.1 * 2.1e-24 37.2 %
:RPS:PFM   144->218 PF03544 * TonB 2e-11 44.0 %
:HMM:PFM   141->218 PF03544 * TonB 4.5e-25 39.7 78/79  
:BLT:SWISS 141->218 TONB_VIBCH 2e-07 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09156.1 GT:GENE ABF09156.1 GT:PRODUCT TonB-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 2500813..2501472 GB:FROM 2500813 GB:TO 2501472 GB:DIRECTION + GB:PRODUCT TonB-like protein GB:PROTEIN_ID ABF09156.1 GB:DB_XREF GI:93355067 InterPro:IPR006260 LENGTH 219 SQ:AASEQ MFDQRFFKITIAVLLFHAGLLYLIQSGLARKMTEAVIAPEIIARIIPMEPPQQPPAPEPPKQQPQTPPKQVKVVTPRPTPPKPQPTPTPVASLPPSPTAIEAPPAPPAPPAPAPEPAAPAAPANAAPRAVGIGEIACSPPQVTYPSQSRRMGETGKTVVRLTTDETGHVVKTAIVTSSGSTRLDTAAVNAVQAMRCKPYMDNGRAVAVTAQQPINFELN GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 141->218|TONB_VIBCH|2e-07|30.8|78/244| TM:NTM 2 TM:REGION 6->28| TM:REGION 32->49| SEG 50->90|ppqqppapeppkqqpqtppkqvkvvtprptppkpqptptpv| SEG 94->129|ppsptaieappappappapapepaapaapanaapra| RP:PFM:NREP 1 RP:PFM:REP 144->218|PF03544|2e-11|44.0|75/79|TonB| HM:PFM:NREP 1 HM:PFM:REP 141->218|PF03544|4.5e-25|39.7|78/79|TonB| GO:PFM:NREP 3 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF03544|IPR003538| GO:PFM GO:0006826|"GO:iron ion transport"|PF03544|IPR003538| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03544|IPR003538| RP:SCP:NREP 1 RP:SCP:REP 146->219|1ihrA|6e-15|18.8|69/73|d.212.1.2| HM:SCP:REP 104->219|1lr0A_|2.1e-24|37.2|113/126|d.212.1.1|1/1|TolA/TonB C-terminal domain| OP:NHOMO 53 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1111113111111111111-11131111--111-1-------1---11-1----------111-----------------------------------------------------------------------1-------------------------------------------------------------------------11--------------------------------------------------------------------------------1---------------------------------111-------1--11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,50-72,80-85,103-122| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccHHEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccHHHHHHcccccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEEEc //